Protein detail
RAB8A
Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel)
Entry name RAB8A | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel)
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization6
Tissue SpecificovaryCell SpecificDecidual stromal cellsSingle-Nuclei Brain SpecificfibroblastSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway7
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Cellular Component (24)
- GO:0000139 Golgi membrane
- GO:0005764 lysosome
- GO:0005768 endosome
- GO:0005813 centrosome
- GO:0005814 centriole
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005929 cilium
- GO:0008021 synaptic vesicle
- GO:0010008 endosome membrane
Page 1 of 3
Molecular Function (7)
Biological Process (3)
KEGG (7)
Reactome (17)
- R-hsa-5620912 anchoring of the basal body to the plasma membrane
- R-hsa-5620920 cargo trafficking to the periciliary membrane
- R-hsa-1640170 cell cycle
- R-hsa-69278 cell cycle mitotic
- R-hsa-5617833 cilium assembly
- R-hsa-199991 membrane trafficking
- R-hsa-453274 mitotic g2 g2 m phases
- R-hsa-1852241 organelle biogenesis and maintenance
- R-hsa-597592 post translational protein modification
- R-hsa-8876198 rab gefs exchange gtp for gdp on rabs
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence30
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RAB8A | STK24 | Q9Y6E0 | T | 72 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:32227113 |
| RAB8A | MAP3K7 | O43318 | T | 72 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:32227113 |
| RAB8A | LRRK2 | Q5S007 | T | 72 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperREACH_ProtMapperPhosphoSite | ProtMapper:29482628ProtMapper:30209220SIGNOR:32227113ProtMapper:29357897ProtMapper:29308544 |
| RAB8A | PINK1 | Q9BXM7 | S | 111 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapper | ProtMapper:28860483SIGNOR:31361120ProtMapper:26471730 |
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (7)
7 records.
Protein Complex Composition (11)
11 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HD-RAB8A-OPTN complex | HTTOPTNRAB8A | P42858P61006Q96CV9 | 1:1:1 | CompleatCORUM | CORUM:2241Compleat:HC1303 | 11137014 |
| HOOK2-PCM1-RAB8A complex | HOOK2PCM1RAB8A | P61006Q15154Q96ED9 | 0:0:0 | CORUM | CORUM:7442 | 21998199 |
| HT_DM_Cluster147 | AGTRAPRAB10RAB8ARAB8BSSR1TSPOTSPO2 | B1AH88P43307P61006P61026Q5TGU0Q6RW13Q92930 | 1:1:1:1:1:1:1 | Compleat | Compleat:HC476 | 22036573 |
| ASPDHRAB8A | A6ND91P61006 | 0:0 | hu.MAP | |||
| RAB8A | P61006 | 5 | PDB | PDB:4lhwPDB:6stfPDB:4lhvPDB:6stgPDB:6whe | ||
| OCRLRAB8A | P61006Q01968 | 4:4 | PDB | PDB:3qbt | ||
| RAB3IL1RAB8A | P61006Q8TBN0 | 2:4 | PDB | PDB:4li0 | ||
| RAB8ARAB8B | P61006Q92930 | 0:0 | hu.MAP2 | |||
| RAB8ARILPL2 | P61006Q969X0 | 2:2 | PDB | PDB:6sq2PDB:6rirPDB:7lwb | ||
| OPTNRAB8A | P61006Q96CV9 | 2:2 | PDB | PDB:9ikq |
Page 1 of 2Next
Isolation & Detection Technology (1)
Sequence, Structure & Domains13
Sequences
Length
207
Mass
23,668
Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P61006-1; Sequence=Displayed; Name=2; IsoId=P61006-2; Sequence=VSP_056399
Alternative Sequence
161..205; AFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCV -> RYQSKNGQKIGRQQPPGEQPGSQNHTGPAEEEQLFPMCSSVRNTA (in isoform 2)
3D Structural Models
Turn
38..41; 69..72; 122..124; 152..155
Helix
21..30; 73..78; 93..97; 99..109; 126..128; 133..142; 158..174
Beta Strand
7..14; 34..36; 42..52; 55..64; 65..67; 82..89; 115..121; 146..149
3D Structure
X-ray crystallography (20)
Domain & Motif Annotations
Motif
31..45; Switch 1; 63..80; Switch 2
Domain (CC)
Switch 1, switch 2 and the interswitch regions are characteristic of Rab GTPases and mediate the interactions with Rab downstream effectors. The switch regions undergo conformational changes upon nucleotide binding which drives interaction with specific sets of effector proteins, with most effectors only binding to GTP-bound Rab.
Protein Families (2)
- Small GTPase superfamily
- Rab family
Sequence Similarities
Belongs to the small GTPase superfamily. Rab family.
Clinical Relevance3
Interaction Protein (6)
ENSG00000072274ENSG00000123240ENSG00000127328ENSG00000138190ENSG00000166128ENSG00000203879
Interaction Count
6
Interaction Dataset (2)
intact_biogridbiogrid_bioplex
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No abstract available |