Protein detail
RAB8A
Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel)
Entry name RAB8A | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel)
Protein Function
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificovaryCell SpecificDecidual stromal cellsSingle-Nuclei Brain SpecificfibroblastSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway
Protein Function
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005764 lysosome
- GO:0005768 endosome
- GO:0005813 centrosome
- GO:0005814 centriole
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005929 cilium
- GO:0008021 synaptic vesicle
- GO:0010008 endosome membrane
- GO:0030140 trans-Golgi network transport vesicle
- GO:0030496 midbody
- GO:0030670 phagocytic vesicle membrane
- GO:0032588 trans-Golgi network membrane
- GO:0036064 ciliary basal body
- GO:0043025 neuronal cell body
- GO:0043197 dendritic spine
- GO:0045335 phagocytic vesicle
- GO:0055038 recycling endosome membrane
- GO:0060170 ciliary membrane
- GO:0070062 extracellular exosome
- GO:0097546 ciliary base
- GO:0097730 non-motile cilium
- GO:0098978 glutamatergic synapse
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-5620912 anchoring of the basal body to the plasma membrane
- R-hsa-5620920 cargo trafficking to the periciliary membrane
- R-hsa-1640170 cell cycle
- R-hsa-69278 cell cycle mitotic
- R-hsa-5617833 cilium assembly
- R-hsa-199991 membrane trafficking
- R-hsa-453274 mitotic g2 g2 m phases
- R-hsa-1852241 organelle biogenesis and maintenance
- R-hsa-597592 post translational protein modification
- R-hsa-8876198 rab gefs exchange gtp for gdp on rabs
- R-hsa-8873719 rab geranylgeranylation
- R-hsa-9007101 rab regulation of trafficking
- R-hsa-2565942 regulation of plk1 activity at g2 m transition
- R-hsa-8854214 tbc rabgaps
- R-hsa-1445148 translocation of slc2a4 glut4 to the plasma membrane
- R-hsa-5653656 vesicle mediated transport
- R-hsa-5620916 vxpx cargo targeting to cilium
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RAB8A | STK24 | Q9Y6E0 | T | 72 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:32227113 |
| RAB8A | MAP3K7 | O43318 | T | 72 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:32227113 |
| RAB8A | LRRK2 | Q5S007 | T | 72 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperREACH_ProtMapperPhosphoSite | ProtMapper:29482628ProtMapper:30209220SIGNOR:32227113ProtMapper:29357897ProtMapper:29308544 |
| RAB8A | PINK1 | Q9BXM7 | S | 111 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapper | ProtMapper:28860483SIGNOR:31361120ProtMapper:26471730 |
Ligand-Receptor Signaling
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
7 records.
Protein Complex Composition
11 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HD-RAB8A-OPTN complex | HTTOPTNRAB8A | P42858P61006Q96CV9 | 1:1:1 | CompleatCORUM | CORUM:2241Compleat:HC1303 | 11137014 |
| HOOK2-PCM1-RAB8A complex | HOOK2PCM1RAB8A | P61006Q15154Q96ED9 | 0:0:0 | CORUM | CORUM:7442 | 21998199 |
| HT_DM_Cluster147 | AGTRAPRAB10RAB8ARAB8BSSR1TSPOTSPO2 | B1AH88P43307P61006P61026Q5TGU0Q6RW13Q92930 | 1:1:1:1:1:1:1 | Compleat | Compleat:HC476 | 22036573 |
| ASPDHRAB8A | A6ND91P61006 | 0:0 | hu.MAP | |||
| RAB8A | P61006 | 5 | PDB | PDB:4lhwPDB:6stfPDB:4lhvPDB:6stgPDB:6whe | ||
| OCRLRAB8A | P61006Q01968 | 4:4 | PDB | PDB:3qbt | ||
| RAB3IL1RAB8A | P61006Q8TBN0 | 2:4 | PDB | PDB:4li0 | ||
| RAB8ARAB8B | P61006Q92930 | 0:0 | hu.MAP2 | |||
| RAB8ARILPL2 | P61006Q969X0 | 2:2 | PDB | PDB:6sq2PDB:6rirPDB:7lwb | ||
| OPTNRAB8A | P61006Q96CV9 | 2:2 | PDB | PDB:9ikq |
Page 1 of 2Next
Isolation & Detection Technology
Sequence, Structure & Domains
Sequences
Length
207
Mass
23,668
Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P61006-1; Sequence=Displayed; Name=2; IsoId=P61006-2; Sequence=VSP_056399
Alternative Sequence
161..205; AFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCV -> RYQSKNGQKIGRQQPPGEQPGSQNHTGPAEEEQLFPMCSSVRNTA (in isoform 2)
3D Structural Models
Turn
38..41; 69..72; 122..124; 152..155
Helix
21..30; 73..78; 93..97; 99..109; 126..128; 133..142; 158..174
Beta Strand
7..14; 34..36; 42..52; 55..64; 65..67; 82..89; 115..121; 146..149
3D Structure
X-ray crystallography (20)
Domain & Motif Annotations
Motif
31..45; Switch 1; 63..80; Switch 2
Domain (CC)
Switch 1, switch 2 and the interswitch regions are characteristic of Rab GTPases and mediate the interactions with Rab downstream effectors. The switch regions undergo conformational changes upon nucleotide binding which drives interaction with specific sets of effector proteins, with most effectors only binding to GTP-bound Rab.
Protein Families
- Small GTPase superfamily
- Rab family
Sequence Similarities
Belongs to the small GTPase superfamily. Rab family.
Clinical Relevance
Interaction Protein
ENSG00000072274ENSG00000123240ENSG00000127328ENSG00000138190ENSG00000166128ENSG00000203879
Interaction Count
6
Interaction Dataset
intact_biogridbiogrid_bioplex