Protein detail
UB2D3
Ubiquitin-conjugating enzyme E2 D3 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D3) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2(17)KB 3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (Ubiquitin-protein ligase D3)
Entry name UB2D3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification EnzymesEssential proteinsMetabolic proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Ubiquitin-conjugating enzyme E2 D3 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D3) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2(17)KB 3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (Ubiquitin-protein ligase D3)
Protein Class (4)
EnzymesEssential proteinsMetabolic proteinsPredicted intracellular proteins
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
UbcH5C
Gene Description
Ubiquitin conjugating enzyme E2 D3
Chromosome
4
Position
102794383-102868896
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue Specificchoroid plexusCell SpecificCardiomyocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway7
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component (6)
Molecular Function (5)
Biological Process (3)
KEGG (4)
Reactome (35)
- R-hsa-1280218 adaptive immune system
- R-hsa-983168 antigen processing ubiquitination proteasome degradation
- R-hsa-9612973 autophagy
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1234174 cellular response to hypoxia
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-168928 ddx58 ifih1 mediated induction of interferon alpha beta
- R-hsa-73887 death receptor signaling
- R-hsa-2173795 downregulation of smad2 3 smad4 transcriptional activity
Page 1 of 4
Mediation Categories (3)
Immune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence36
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (11)
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:P22314_P62979 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P22314_P62987 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG47_P22314 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG48_P22314 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| UB2D3 | P61077 | 3MG | P29372 | Yes | Yes | No | SIGNOR | SIGNOR:25207814 |
| UB2D3 | P61077 | UBR5 | O95071 | Yes | Yes | No | HINTSIGNOR | HINT:32029551HINT:11714696SIGNOR:11714696 |
| COMPLEX:A0AVT1_P0CG47 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P62979 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P0CG48 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P62987 | UB2D3 | P61077 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 |
Page 1 of 2Next
Protein Complex Composition (17)
17 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| E3 ubiquitin ligase (BRCA1BARD1) - UbcH5c complex | BARD1BRCA1UBE2D3 | P38398P61077Q99728 | 1:1:1 | CompleatCORUM | CORUM:2822Compleat:HC678 | 12732733 |
| Ub:E2 | UBBUBE2D3 | P0CG47P61077 | 1:1 | SIGNORPDB | PDB:5ifrSIGNOR:SIGNOR-C497 | |
| Ub:E2 | UBCUBE2D3 | P0CG48P61077 | 1:1 | SIGNORPDB | PDB:2fuhPDB:3ugbSIGNOR:SIGNOR-C497 | |
| Ub:E2 | RPS27AUBE2D3 | P61077P62979 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | UBA52UBE2D3 | P61077P62987 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| ACOT13ACOX3RNF4SLC39A7UBA52UBCUBE2D3 | O15254P0CG48P61077P62987P78317Q92504Q9NPJ3 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5803 | ||
| BARD1BRCA1H2AC4H2BC12H3C15H4C4UBE2D3 | O60814P04908P38398P61077P62805Q71DI3Q99728 | 2:2:1:1:2:2:1 | PDB | PDB:8grq | ||
| BARD1H2AC18H2BC12H3C15H4C4UBE2D3 | O60814P61077P62805Q6FI13Q71DI3Q99728 | 2:1:2:2:2:1 | PDB | PDB:7jzv | ||
| MYCBP2UBCUBE2D3 | O75592P0CG48P61077 | 1:1:1 | PDB | PDB:6t7f | ||
| UBE2D3UBE4B | O95155P61077 | 1:1 | PDB | PDB:3l1z |
Page 1 of 2Next
Sequence, Structure & Domains12
Sequences
Length
147
Mass
16,687
Sequence
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P61077-1; Sequence=Displayed; Name=2; IsoId=P61077-2; Sequence=VSP_038097; Name=3; IsoId=P61077-3; Sequence=VSP_038096
Alternative Sequence
1..8; MALKRINK -> MLSNRKCLSK (in isoform 3); 134..147; YNRISREWTQKYAM -> YNRLAREWTEKYAML (in isoform 2)
3D Structural Models
Turn
44..47; 58..61; 90..92
Helix
1..15; 87..89; 99..111; 121..129; 131..145
Beta Strand
19..21; 22..28; 32..38; 41..43; 49..55; 66..71; 76..78; 80..84; 115..117
3D Structure
Electron microscopy (24); NMR spectroscopy (1); X-ray crystallography (19)
Domain & Motif Annotations
Domain (FT)
1..147; UBC core
Protein Families
Ubiquitin-conjugating enzyme family
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.
Clinical Relevance4
Antibody
Interaction Protein (23)
ENSG00000022840ENSG00000070423ENSG00000101871ENSG00000101966ENSG00000103429ENSG00000108375ENSG00000121481ENSG00000123091ENSG00000157450ENSG00000159461ENSG00000163481ENSG00000165886ENSG00000167770ENSG00000168411ENSG00000173456ENSG00000175104ENSG00000178498ENSG00000183496ENSG00000186187ENSG00000196470ENSG00000204308ENSG00000204599ENSG00000265491
Interaction Count
23
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 27863537 | High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources. | No abstract available |