EV MemProt Atlas

Basic Information

Protein Names

Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12)

Protein Class (7)

Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins

Protein Function (10)

Cancer-related genes:Mutational cancer driver genes
Predicted intracellular proteins
Cancer-related genes:Mutated cancer genes
Potential drug targets
RAS pathway related proteins
Enzymes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
ENZYME proteins:Hydrolases
Disease related genes

Ensembl

ENSG00000067560

Entrez Gene Symbol

RHOA

Gene Synonym (4)

ARH12ARHARho12RHOH12

Gene Description

Ras homolog family member A

Chromosome

3

Position

49359139-49412998

Supporting publications (n)

2

EVMP confidence score

0.40

Fluorescence & Localization

Cell SpecificSomatotrophsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway

Protein Function (10)

Cancer-related genes:Mutational cancer driver genes
Predicted intracellular proteins
Cancer-related genes:Mutated cancer genes
Potential drug targets
RAS pathway related proteins
Enzymes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
ENZYME proteins:Hydrolases
Disease related genes

Cellular Component (23)

Page 1 of 3

Molecular Function (6)

Biological Process (3)

KEGG (44)

Page 1 of 5

Reactome (49)

Page 1 of 5

Mediation Categories (6)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence140

Enzyme-Mediated Modification (19)

19 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
RHOA	AKAP12	Q02952	S	188	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:29391485
RHOA	KCNIP3	Q9Y2W7	S	188	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:29652865
RHOA	PRKCE	Q02156	S	188	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:24191200
RHOA	PRKCE	Q02156	T	127	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:24191200
RHOA	SLK	Q9H2G2	S	188	phosphorylation	RLIMS-P_ProtMapperProtMapper	ProtMapper:18420945
RHOA	ROCK1	Q13464	T	100	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:26816343
RHOA	EGF	P01133	T	100	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:26816343
RHOA	EGF	P01133	S	88	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:26816343
RHOA	STK24	Q9Y6E0	S	26	phosphorylation	REACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:24872548

Page 2 of 2Previous

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database
intracellular	intracellular	LOCATE
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	UniProt_location
intracellular	intracellular	OmniPath
plasma_membrane	plasma_membrane	UniProt_location
plasma_membrane	plasma_membrane	OmniPath

Regulatory Interaction Network (90)

90 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
RHG23	Q9P227	RHOA	P61586	Yes		Yes	SIGNOR	SIGNOR:32203420
NGEF	Q8N5V2	RHOA	P61586	Yes	Yes		SIGNORHINTACSNWangSPIKE_LC	ACSN:9113980 ACSN:9789025 SIGNOR:32203420 HINT:32203420 SPIKE_LC:18256687 ACSN:11149925 ACSN:9641915 HINT:18256687
GDS1	P52306	RHOA	P61586	Yes	Yes		SIGNORHPRDHINTACSNInnateDBSPIKE_LCLit-BM-17	Lit-BM-17:11948427 ACSN:9113980 HINT:30190425 HINT:35271311 ACSN:9789025 HPRD:11948427 HINT:11948427 HINT:34591642 InnateDB:11948427 SIGNOR:21242305 Lit-BM-17:20709748 SPIKE_LC:16189514 ACSN:11149925 ACSN:9641915 HINT:33961781
ARHG5	Q12774	RHOA	P61586	Yes	Yes		SIGNORCui2007HINTWangSPIKE_LC	HINT:12006984 SPIKE_LC:17145710 HINT:34591642 HINT:32203420 SIGNOR:32203420
RHOA	P61586	EZRI	P15311	Yes	Yes		WangAdhesomeiPTMnetSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapper	ProtMapper:31775562 ProtMapper:35267019 ProtMapper:20737283 SIGNOR:35267019 Adhesome:15659383
BACD1	Q8WZ19	RHOA	P61586	Yes		Yes	HINTSIGNOR	HINT:26100637 HINT:19782033 SIGNOR:19782033
RHG21	Q5T5U3	RHOA	P61586	Yes		Yes	HPRDSIGNOR	HPRD:15793564 SIGNOR:32203420
MET	P08581	RHOA	P61586	Yes			Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:28712859 PhosphoSite:31056743 PhosphoSite:31973815 ProtMapper:31056743 ProtMapper:32392742
	A9UF07	RHOA	P61586	Yes			PhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:23027962
MK03	P27361	RHOA	P61586	Yes	Yes		PhosphoSite_norefiPTMnetProtMapperWangPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:26816343

Page 9 of 9Previous

Protein Complex Composition (23)

23 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ARHGEF2 RASGRF1 RHOA RRAS2 UBC	P0CG48 P61586 P62070 Q13972 Q92974	1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5811
RAP1GDS1 RHOA	P52306 P61586	4:4	PDB	PDB:5zhx
ARHGDIA RHOA	P52565 P61586	2:2	PDB	PDB:1cc0
RHOA	P61586	2	PDB	PDB:5jcp
ARHGAP1 RHOA	P61586 Q07960	2:2	PDB	PDB:6r3vPDB:5m6xPDB:1ow3PDB:5m70PDB:7qscPDB:1tx4PDB:7qtm
AKAP13 RHOA	P61586 Q12802	2:2	PDB	PDB:6bcaPDB:4d0n
MYO9B RHOA	P61586 Q13459	2:2	PDB	PDB:5hpy
RHOA ROCK1	P61586 Q13464	2:2	PDB	PDB:1s1c
NET1 RHOA	P61586 Q7Z628	2:2	PDB	PDB:4xh9
ARHGEF2 RHOA	P61586 Q92974	1:1	PDB	PDB:7g8dPDB:7g9hPDB:7g8cPDB:7g83PDB:7g8yPDB:7g90PDB:7g8nPDB:7g8oPDB:7g8lPDB:7g9fPDB:7g89PDB:7g8sPDB:7g97PDB:7g84PDB:7g8zPDB:7g8gPDB:7g94PDB:7g82PDB:7g96PDB:7g9jPDB:7g86PDB:7g8qPDB:7g8uPDB:7g8wPDB:7g93PDB:7g98PDB:7g8fPDB:7g8tPDB:7g9bPDB:7g8xPDB:7g9cPDB:7g8iPDB:7g9dPDB:7g8vPDB:7g8mPDB:7g8bPDB:7g91PDB:7g9aPDB:7g92PDB:7g9iPDB:7g8jPDB:7g80PDB:7g81PDB:8bntPDB:7g8rPDB:7g8hPDB:7g8ePDB:7g8aPDB:7g8kPDB:7g9gPDB:7g85PDB:7g88PDB:7g87PDB:7g99PDB:7g95PDB:7g8pPDB:7g9e

Page 2 of 3Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Immunoelectron MicroscopyMass spectrometry	9	38113368 38895962 33592500 32854315 38014595 41307968 35763041 32230970 39001700

Sequence, Structure & Domains

Sequences

Length

193

Mass

21,768

Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

3D Structural Models

Turn

67..69; 133..135; 161..163; 182..184

Helix

14..16; 18..23; 64..66; 70..73; 89..97; 99..106; 119..121; 125..132; 141..151; 167..179

Beta Strand

4..13; 27..29; 42..48; 51..58; 78..85; 107..109; 112..117; 154..158; 185..187; 190..193

3D Structure

Electron microscopy (8); X-ray crystallography (115)

Domain & Motif Annotations

Motif

34..42; Effector region

Domain (CC)

(Microbial infection) The basic-rich region is essential for yopT recognition and cleavage.

Region

61..78; Switch II region; involved in RAP1GDS1 isoform 2 binding

Protein Families (2)

Small GTPase superfamily
Rho family

Sequence Similarities

Belongs to the small GTPase superfamily. Rho family.

Clinical Relevance

Disease Involvement (4)

Cancer-related genesDisease variantEctodermal dysplasiaProto-oncogene

Related Diseases (2)

Ectodermal dysplasia Solid tumour/cancer

Biomarker

Discontinued in Phase 1

Drugs (7)

ROTTLERIN PRAVASTATIN SODIUM QUINIDINE CLAUSINE E SIMVASTATIN NS004 NS1619

Antibody

CAB005052

Interaction Protein (21)

ENSG00000042062ENSG00000050327ENSG00000064601ENSG00000067900ENSG00000100592ENSG00000111276ENSG00000111913ENSG00000114993ENSG00000116584ENSG00000131504ENSG00000132694ENSG00000133030ENSG00000133703ENSG00000138698ENSG00000141522ENSG00000142675ENSG00000143878ENSG00000155366ENSG00000175220ENSG00000196914ENSG00000204310

Interaction Count

21

Interaction Dataset (4)

intact_biogridbiogrid_bioplexbiogrid_opencellintact_biogrid_opencell

Supporting Publications2

PMID	Title	Related sentences
27894104	Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers.	No related sentences available
29148239	Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants.	No related sentences available

Entry name RHOA	UniProt ID P61586	EVMP confidence score 0.40
Supporting publications (n) 2	Transmembrane count	Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins