Protein detail
RHOA
Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12)
Entry name RHOA | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12)
Protein Class (7)
Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins
Protein Function (10)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
ARH12ARHARho12RHOH12
Gene Description
Ras homolog family member A
Chromosome
3
Position
49359139-49412998
Supporting publications (n)
2
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificSomatotrophsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function (10)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component (23)
- GO:0005634 nucleus
- GO:0005768 endosome
- GO:0005789 endoplasmic reticulum membrane
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0005938 cell cortex
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0030027 lamellipodium
Page 1 of 3
Molecular Function (6)
Biological Process (3)
KEGG (44)
- hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04144 Endocytosis
- KEGG:hsa04150 mTOR signaling pathway
Page 1 of 5
Reactome (49)
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-73887 death receptor signaling
- R-hsa-5688426 deubiquitination
- R-hsa-3928663 epha mediated growth cone collapse
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-6785631 erbb2 regulates cell motility
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-392451 g beta gamma signalling through pi3kgamma
Page 1 of 5
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence140
Enzyme-Mediated Modification (19)
19 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RHOA | SRC | P12931 | Y | 66 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:23027962 |
| RHOA | SRC | P12931 | Y | 34 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:23027962 |
| RHOA | PRKACA | P17612 | S | 188 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:12654918HPRD:12654918KEA:12654918 |
| RHOA | MAPK3 | P27361 | S | 88 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| RHOA | MAPK3 | P27361 | T | 100 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| RHOA | PRKG1 | Q13976 | S | 188 | phosphorylation | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:20696841ProtMapper:11162591 |
| RHOA | MET | P08581 | Y | 42 | phosphorylation | PhosphoSite | |
| RHOA | PRKX | P51817 | S | 188 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| RHOA | PRKY | O43930 | S | 188 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| RHOA | GPI | P06744 | S | 188 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:28717253 |
Page 1 of 2Next
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (90)
90 records.
Protein Complex Composition (23)
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
193
Mass
21,768
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
3D Structural Models
Turn
67..69; 133..135; 161..163; 182..184
Helix
14..16; 18..23; 64..66; 70..73; 89..97; 99..106; 119..121; 125..132; 141..151; 167..179
Beta Strand
4..13; 27..29; 42..48; 51..58; 78..85; 107..109; 112..117; 154..158; 185..187; 190..193
3D Structure
Electron microscopy (8); X-ray crystallography (115)
Domain & Motif Annotations
Motif
34..42; Effector region
Domain (CC)
(Microbial infection) The basic-rich region is essential for yopT recognition and cleavage.
Region
61..78; Switch II region; involved in RAP1GDS1 isoform 2 binding
Protein Families (2)
- Small GTPase superfamily
- Rho family
Sequence Similarities
Belongs to the small GTPase superfamily. Rho family.
Clinical Relevance
Disease Involvement (4)
Cancer-related genesDisease variantEctodermal dysplasiaProto-oncogene
Related Diseases (2)
Biomarker
Discontinued in Phase 1
Antibody
Interaction Protein (21)
ENSG00000042062ENSG00000050327ENSG00000064601ENSG00000067900ENSG00000100592ENSG00000111276ENSG00000111913ENSG00000114993ENSG00000116584ENSG00000131504ENSG00000132694ENSG00000133030ENSG00000133703ENSG00000138698ENSG00000141522ENSG00000142675ENSG00000143878ENSG00000155366ENSG00000175220ENSG00000196914ENSG00000204310
Interaction Count
21
Interaction Dataset (4)
intact_biogridbiogrid_bioplexbiogrid_opencellintact_biogrid_opencell
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No related sentences available |