Protein detail
RHOA
Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12)
Protein symbol RHOA | UniProt ID | EVMP score 0.50 |
Frequency 2 | Transmembrane count | Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12)
Protein Class
Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
ARH12ARHARho12RHOH12
Gene Description
Ras homolog family member A
Chromosome
3
Position
49359139-49412998
Frequency
2
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificSomatotrophsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component
- GO:0005634 nucleus
- GO:0005768 endosome
- GO:0005789 endoplasmic reticulum membrane
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0005938 cell cortex
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0030027 lamellipodium
- GO:0030054 cell junction
- GO:0030496 midbody
- GO:0030667 secretory granule membrane
- GO:0031982 vesicle
- GO:0032154 cleavage furrow
- GO:0032587 ruffle membrane
- GO:0043197 dendritic spine
- GO:0043296 apical junction complex
- GO:0070062 extracellular exosome
- GO:0071944 cell periphery
- GO:0098794 postsynapse
- GO:0098978 glutamatergic synapse
- GO:0101003 ficolin-1-rich granule membrane
Molecular Function
Biological Process
KEGG
- hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04144 Endocytosis
- KEGG:hsa04150 mTOR signaling pathway
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04350 TGF-beta signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04520 Adherens junction
- KEGG:hsa04530 Tight junction
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04621 NOD-like receptor signaling pathway
- KEGG:hsa04625 C-type lectin receptor signaling pathway
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04670 Leukocyte transendothelial migration
- KEGG:hsa04722 Neurotrophin signaling pathway
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04928 Parathyroid hormone synthesis, secretion and action
- KEGG:hsa04972 Pancreatic secretion
- KEGG:hsa05100 Bacterial invasion of epithelial cells
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05132 Salmonella infection
- KEGG:hsa05133 Pertussis
- KEGG:hsa05135 Yersinia infection
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05203 Viral carcinogenesis
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05206 MicroRNAs in cancer
- KEGG:hsa05210 Colorectal cancer
- KEGG:hsa05417 Lipid and atherosclerosis
- KEGG:hsa05418 Fluid shear stress and atherosclerosis
Reactome
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-73887 death receptor signaling
- R-hsa-5688426 deubiquitination
- R-hsa-3928663 epha mediated growth cone collapse
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-6785631 erbb2 regulates cell motility
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-392451 g beta gamma signalling through pi3kgamma
- R-hsa-397795 g protein beta gamma signalling
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-9675108 nervous system development
- R-hsa-6798695 neutrophil degranulation
- R-hsa-5689896 ovarian tumor domain proteases
- R-hsa-193697 p75ntr regulates axonogenesis
- R-hsa-193704 p75 ntr receptor mediated signalling
- R-hsa-4086400 pcp ce pathway
- R-hsa-198203 pi3k akt activation
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-597592 post translational protein modification
- R-hsa-8849471 ptk6 regulates rho gtpases ras gtpase and map kinases
- R-hsa-8980692 rhoa gtpase cycle
- R-hsa-9013106 rhoc gtpase cycle
- R-hsa-5625900 rho gtpases activate cit
- R-hsa-5663220 rho gtpases activate formins
- R-hsa-5625970 rho gtpases activate ktn1
- R-hsa-5625740 rho gtpases activate pkns
- R-hsa-5666185 rho gtpases activate rhotekin and rhophilins
- R-hsa-5627117 rho gtpases activate rocks
- R-hsa-9012999 rho gtpase cycle
- R-hsa-195258 rho gtpase effectors
- R-hsa-416572 sema4d induced cell migration and growth cone collapse
- R-hsa-400685 sema4d in semaphorin signaling
- R-hsa-416550 sema4d mediated inhibition of cell attachment and migration
- R-hsa-373755 semaphorin interactions
- R-hsa-1227986 signaling by erbb2
- R-hsa-372790 signaling by gpcr
- R-hsa-166520 signaling by ntrks
- R-hsa-8848021 signaling by ptk6
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-376176 signaling by robo receptors
- R-hsa-9006936 signaling by tgfb family members
- R-hsa-170834 signaling by tgf beta receptor complex
- R-hsa-194138 signaling by vegf
- R-hsa-195721 signaling by wnt
- R-hsa-2173791 tgf beta receptor signaling in emt epithelial to mesenchymal transition
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
19 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RHOA | AKAP12 | Q02952 | S | 188 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:29391485 |
| RHOA | KCNIP3 | Q9Y2W7 | S | 188 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:29652865 |
| RHOA | PRKCE | Q02156 | S | 188 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:24191200 |
| RHOA | PRKCE | Q02156 | T | 127 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:24191200 |
| RHOA | SLK | Q9H2G2 | S | 188 | phosphorylation | RLIMS-P_ProtMapperProtMapper | ProtMapper:18420945 |
| RHOA | ROCK1 | Q13464 | T | 100 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:26816343 |
| RHOA | EGF | P01133 | T | 100 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:26816343 |
| RHOA | EGF | P01133 | S | 88 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:26816343 |
| RHOA | STK24 | Q9Y6E0 | S | 26 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:24872548 |
Page 2 of 2Previous
Ligand-Receptor Signaling
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
90 records.
Page 1 of 9Next
Protein Complex Composition
23 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GTP-Rho-Rhpn1-Ropn1 complex | RHOARHPN1RHPN2ROPN1ROPN1B | P61586Q8IUC4Q8TCX5Q9BZX4Q9HAT0 | 1:1:1:1:1 | Compleat | Compleat:HC3078 | 10591629 |
| MRIP-MBS-RHOA complex | MPRIPPPP1R12ARHOA | O14974P61586Q6WCQ1 | 1:1:1 | CompleatCORUM | Compleat:HC263CORUM:815 | 14506264 |
| MRIP-RHOA complex | MPRIPRHOA | P61586Q6WCQ1 | 1:1 | CompleatCORUM | CORUM:816Compleat:HC2875 | 14506264 |
| RAC1-RHOA-VANGL2 complex | RAC1RHOAVANGL2 | P61586P63000Q9ULK5 | 0:0:0 | CORUM | CORUM:7331 | 20067994 |
| RHOA-IP3R-TRPC1 complex | ITPR1RHOATRPC1 | P48995P61586Q14643 | 1:1:1 | CompleatCORUM | CORUM:553Compleat:HC612 | 12766172 |
| PLIN3PON2PPP1R12ARHOA | O14974O60664P61586Q15165 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_267 | ||
| AKAP13KPNB1NXT1RANRANBP1RANBP2RANBP3RANGAP1RCC1RHOAUBBUBCXPO1 | O14980P0CG47P0CG48P18754P43487P46060P49792P61586P62826Q12802Q14974Q9H6Z4Q9UKK6 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5673 | ||
| ARHGDIBCLIP3PRKCGRHOASH3BP1UBC | P05129P0CG48P52566P61586Q96DZ5Q9Y3L3 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5445 | ||
| RHOARHOC | P08134P61586 | 0:0 | hu.MAP2 | |||
| ARHGDIBCLIP3NET1RHOASH3BP1UBC | P0CG48P52566P61586Q7Z628Q96DZ5Q9Y3L3 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5103 |
Page 1 of 3Next
Isolation & Detection Technology
Sequence, Structure & Domains
Sequences
Length
193
Mass
21,768
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
3D Structural Models
Turn
67..69; 133..135; 161..163; 182..184
Helix
14..16; 18..23; 64..66; 70..73; 89..97; 99..106; 119..121; 125..132; 141..151; 167..179
Beta Strand
4..13; 27..29; 42..48; 51..58; 78..85; 107..109; 112..117; 154..158; 185..187; 190..193
3D Structure
Electron microscopy (8); X-ray crystallography (115)
Domain & Motif Annotations
Motif
34..42; Effector region
Domain (CC)
(Microbial infection) The basic-rich region is essential for yopT recognition and cleavage.
Region
61..78; Switch II region; involved in RAP1GDS1 isoform 2 binding
Protein Families
- Small GTPase superfamily
- Rho family
Sequence Similarities
Belongs to the small GTPase superfamily. Rho family.
Clinical Relevance
Disease Involvement
Cancer-related genesDisease variantEctodermal dysplasiaProto-oncogene
Related Diseases
Biomarker
Discontinued in Phase 1
Antibody
Interaction Protein
ENSG00000042062ENSG00000050327ENSG00000064601ENSG00000067900ENSG00000100592ENSG00000111276ENSG00000111913ENSG00000114993ENSG00000116584ENSG00000131504ENSG00000132694ENSG00000133030ENSG00000133703ENSG00000138698ENSG00000141522ENSG00000142675ENSG00000143878ENSG00000155366ENSG00000175220ENSG00000196914ENSG00000204310
Interaction Count
21
Interaction Dataset
intact_biogridbiogrid_bioplexbiogrid_opencellintact_biogrid_opencell