Protein detail
GBG11
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Protein symbol GBG11 | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count | Protein classification Predicted intracellular proteinsRAS pathway related proteins |
Basic Information
Protein Names
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Protein Class
Predicted intracellular proteinsRAS pathway related proteins
Protein Function
- Predicted intracellular proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
GNGT11
Gene Description
G protein subunit gamma 11
Chromosome
7
Position
93921735-93928610
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificchoroid plexusBrain Regional Specificchoroid plexusCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
- KEGG:hsa04726 Serotonergic synapse
- KEGG:hsa04727 GABAergic synapse
- KEGG:hsa04728 Dopaminergic synapse
- KEGG:hsa04926 Relaxin signaling pathway
- KEGG:hsa05032 Morphine addiction
- KEGG:hsa05034 Alcoholism
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05200 Pathways in cancer
Reactome
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-373080 class b 2 secretin family receptors
- R-hsa-6814122 cooperation of pdcl phlp1 and tric cct in g protein beta folding
- R-hsa-8939211 esr mediated signaling
- R-hsa-9009391 extra nuclear estrogen signaling
- R-hsa-977444 gaba b receptor activation
- R-hsa-977443 gaba receptor activation
- R-hsa-381676 glucagon like peptide 1 glp1 regulates insulin secretion
- R-hsa-163359 glucagon signaling in metabolic regulation
- R-hsa-420092 glucagon type ligand receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-9634597 gper1 signaling
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-418594 g alpha i signalling events
- R-hsa-416476 g alpha q signalling events
- R-hsa-418555 g alpha s signalling events
- R-hsa-418597 g alpha z signalling events
- R-hsa-8964616 g beta gamma signalling through cdc42
- R-hsa-392451 g beta gamma signalling through pi3kgamma
- R-hsa-202040 g protein activation
- R-hsa-397795 g protein beta gamma signalling
- R-hsa-109582 hemostasis
- R-hsa-9856530 high laminar flow shear stress activates signaling by piezo1 and pecam1 cdh5 kdr in endothelial cells
- R-hsa-5663205 infectious disease
- R-hsa-163685 integration of energy metabolism
- R-hsa-1296065 inwardly rectifying k channels
- R-hsa-9658195 leishmania infection
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-111885 opioid signalling
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-418346 platelet homeostasis
- R-hsa-1296071 potassium channels
- R-hsa-500657 presynaptic function of kainate receptors
- R-hsa-392851 prostacyclin signalling through prostacyclin receptor
- R-hsa-391251 protein folding
- R-hsa-422356 regulation of insulin secretion
- R-hsa-372790 signaling by gpcr
- R-hsa-9006931 signaling by nuclear receptors
- R-hsa-195721 signaling by wnt
- R-hsa-392518 signal amplification
- R-hsa-456926 thrombin signalling through proteinase activated receptors pars
- R-hsa-428930 thromboxane signalling through tp receptor
- R-hsa-112315 transmission across chemical synapses
- R-hsa-382551 transport of small molecules
- R-hsa-432040 vasopressin regulates renal water homeostasis via aquaporins
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GNAI1-GNB5-GNG11 complex | GNAI1GNB5GNG11 | O14775P61952P63096 | 0:0:0 | CORUM | CORUM:7085 | 25733868 |
| GNAI3GNG11RGS12 | O14924P08754P61952 | 0:0:0 | hu.MAP | |||
| GNAI1GNG11RGS12 | O14924P61952P63096 | 0:0:0 | hu.MAP | |||
| GNAI3GNG11RAP1GAP | P08754P47736P61952 | 0:0:0 | hu.MAP |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
73
Mass
8,481
Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
3D Structural Models
Domain & Motif Annotations
Region
51..73; Disordered
Protein Families
G protein gamma family
Sequence Similarities
Belongs to the G protein gamma family.