Protein detail
GBG11
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Entry name GBG11 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count | Protein classification Predicted intracellular proteinsRAS pathway related proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Protein Class (2)
Predicted intracellular proteinsRAS pathway related proteins
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
GNGT11
Gene Description
G protein subunit gamma 11
Chromosome
7
Position
93921735-93928610
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue Specificchoroid plexusBrain Regional Specificchoroid plexusCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway7
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
KEGG (20)
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
Page 1 of 2
Reactome (56)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
Page 1 of 6
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence9
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GNAI1-GNB5-GNG11 complex | GNAI1GNB5GNG11 | O14775P61952P63096 | 0:0:0 | CORUM | CORUM:7085 | 25733868 |
| GNAI3GNG11RGS12 | O14924P08754P61952 | 0:0:0 | hu.MAP | |||
| GNAI1GNG11RGS12 | O14924P61952P63096 | 0:0:0 | hu.MAP | |||
| GNAI3GNG11RAP1GAP | P08754P47736P61952 | 0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation；Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains6
Sequences
Length
73
Mass
8,481
Sequence
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
Domain & Motif Annotations
Region
51..73; Disordered
Protein Families
G protein gamma family
Sequence Similarities
Belongs to the G protein gamma family.