EV MemProt Atlas

Basic Information

Protein Names

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)

Protein Class (4)

EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000172531

Entrez Gene Symbol

PPP1CA

Gene Synonym (4)

PP-1APP1APP1alphaPPP1A

Gene Description

Protein phosphatase 1 catalytic subunit alpha

Chromosome

11

Position

67398181-67421183

Supporting publications (n)

26

EVMP confidence score

0.75

Fluorescence & Localization

Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme

Function & Pathway

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (15)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (23)

Page 1 of 3

Reactome (21)

Page 1 of 3

Canonical Pathways

M200 Pid era genomic pathway

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence133

Enzyme-Mediated Modification (27)

27 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
PPP1CA	CDK3	Q00526	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK10	Q15131	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK4	P11802	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK6	Q00534	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK7	P50613	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK8	P49336	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK11B	P21127	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK19	Q9BWU1	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK9	P50750	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK13	Q14004	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 2 of 3Previous Next

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database
intracellular	intracellular	LOCATE
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	UniProt_location
intracellular	intracellular	OmniPath

Regulatory Interaction Network (44)

44 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PP1A	P62136	TIF1B	Q13263	Yes	Yes		SPIKESPIKE_LCSIGNOR	SPIKE:20424263 SPIKE_LC:20424263 SIGNOR:20424263
PPR1B	Q9UD71	PP1A	P62136	Yes		Yes	WangNetPathSIGNORHPRDLMPIDSPIKE_LCSPIKE	LMPID:9108011 LMPID:10075680 HPRD:9108011 SPIKE:11440854 SPIKE_LC:11440854 LMPID:16428298 NetPath:19651774 SIGNOR:10604473
SMAD7	O15105	PP1A	P62136	Yes	Yes		WangSIGNORSignaLink3	SignaLink3:16571110 SignaLink3:23331499 SIGNOR:16571110
PP1A	P62136	ACVL1	P37023	Yes	Yes		WangSignaLink3	SignaLink3:16571110 SignaLink3:23331499
LMTK2	Q8IWU2	PP1A	P62136	Yes	Yes	Yes	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperHINTSignaLink3SIGNOR_ProtMapperLit-BM-17PhosphoSitePhosphoSite_ProtMapperSPIKE_LC	PhosphoSite:17283141 ProtMapper:12393858 SignaLink3:12393858 Lit-BM-17:12393858 PhosphoSite:16785988 SIGNOR:12393858 PhosphoSite:35081344 PhosphoSite:17202132 PhosphoSite:12202491 HINT:28065597 PhosphoSite:18250156 SignaLink3:23331499 HINT:12393858 SPIKE_LC:12393858 PhosphoSite:29764992 PhosphoSite:24120663
IPP2	P41236	PP1A	P62136	Yes		Yes	LMPIDSIGNORHPRDHINTIntActDIPLit-BM-17	DIP:20826336 IntAct:22321011 Lit-BM-17:26186194 Lit-BM-17:27173435 HINT:28330616 HINT:10807923 HINT:20826336 HINT:22321011 IntAct:10807923 IntAct:20826336 SIGNOR:18250156 Lit-BM-17:28330616 HINT:25593058 LMPID:16428298 HPRD:10807923 Lit-BM-17:22321011 Lit-BM-17:10807923 HINT:33961781
PP1A	P62136	AXIN1	O15169	Yes		Yes	SIGNORProtMapperDEPODACSNSIGNOR_ProtMapperHPRD-phosSPIKE_LC	HPRD-phos:17318175 SIGNOR:17318175 ACSN:17318175 SPIKE_LC:17318175 DEPOD:17318175 ProtMapper:17318175
PP1A	P62136	NOS3	P29474	Yes	Yes		SIGNOR_ProtMapperSIGNORProtMapperDEPOD	ProtMapper:19036824 SIGNOR:19036824 DEPOD:19036824
PP1A	P62136	CASP9	P55211	Yes	Yes		SIGNORProtMapperDEPODACSNSIGNOR_ProtMapper	ProtMapper:16888006 SIGNOR:22311969 SIGNOR:16888006 ACSN:16888006 ACSN:12792650 ProtMapper:22311969 DEPOD:16888006
PP1A	P62136	PREX1	Q8TCU6	Yes	Yes		SIGNOR	SIGNOR:22242915

Page 1 of 5Next

Protein Complex Composition (56)

56 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
SHOC2-MRAS-PPP1CA complex	MRAS PPP1CA SHOC2	O14807 P62136 Q9UQ13	2:2:2	KEGG-MEDICUSComplexPortalPDB	PDB:7upiPDB:7UPIPDB:7TVFintact:EBI-58997210PDB:7tvfPDB:7txhPDB:7TXH	36175670 14755292 35830882 35831509
Sds22p/Glc7p complex	DNAAF1 DRC3 PPP1CA PPP1CB PPP1CC PPP1R7	P36873 P62136 P62140 Q15435 Q8NEP3 Q9H069	1:1:1:1:1:1	Compleat	Compleat:HC1185	10775415
	C2orf74 PPP1CA PPP1R37 ZFYVE16	A8MZ97 O75864 P62136 Q7Z3T8	0:0:0:0	hu.MAP
	C2orf74 HOMEZ PPP1CA PPP1R37	A8MZ97 O75864 P62136 Q8IX15	0:0:0:0	hu.MAP
	C2orf74 PPP1CA PPP1R13L PPP1R37	A8MZ97 O75864 P62136 Q8WUF5	0:0:0:0	hu.MAP
	C2orf74 CSRNP1 PPP1CA PPP1R37	A8MZ97 O75864 P62136 Q96S65	0:0:0:0	hu.MAP
	ADISSP C2orf74 PPP1CA PPP1R37	A8MZ97 O75864 P62136 Q9GZN8	0:0:0:0	hu.MAP
	C2orf74 PLCL2 PPP1CA PPP1R37	A8MZ97 O75864 P62136 Q9UPR0	0:0:0:0	hu.MAP
	BRCA1 CHD1 CSNK2A2 CSNK2B FKBP15 FKBP3 H2AX H3C11 H4C4 KMT2E PPP1CA SSRP1 UHMK1	O14646 P16104 P19784 P38398 P62136 P62805 P67870 P68431 Q00688 Q08945 Q5T1M5 Q8IZD2 Q8TAS1	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7000
	AURKA AURKB CDK1 CENPE HCFC1 KIF11 LMNA NDC80 NUF2 PKMYT1 PPP1CA PPP1CC	O14777 O14965 P02545 P06493 P36873 P51610 P52732 P62136 Q02224 Q96GD4 Q99640 Q9BZD4	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4180

Page 2 of 6Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30379855

Sequence, Structure & Domains

Sequences

Length

330

Mass

37,512

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754

Alternative Sequence

18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)

3D Structural Models

Turn

23..25; 115..117; 132..135; 166..168; 259..262

Helix

9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274

Beta Strand

51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297

3D Structure

Electron microscopy (2); X-ray crystallography (43)

Domain & Motif Annotations

Region

306..330; Disordered

Protein Families (2)

PPP phosphatase family
PP-1 subfamily

Sequence Similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Clinical Relevance

Related Diseases

Molluscum contagiosum

Biomarker

Approved

Drug Targets

Successful target

Drugs (5)

OKADAIC ACID CANTHARIDIN MICROCYSTIN-LR CHEMBL:CHEMBL1503729 DEMETHYL-CANTHARIDIN

Antibody (2)

CAB004545 HPA046833

Interaction Protein (57)

ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667

Interaction Count

57

Interaction Dataset (2)

intact_biogridintact_biogrid_bioplex

Supporting Publications26

PMID	Title	Related sentences
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No related sentences available
40831280	Syntenin Controls Extracellular Vesicle-Induced Tumour Migration by Regulating the Expression of Adhesion Proteins on Small Extracellular Vesicles.	No related sentences available
40840701	Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma.	No related sentences available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No related sentences available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No related sentences available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No related sentences available

Page 3 of 3Previous

Entry name PP1A	UniProt ID P62136	EVMP confidence score 0.75
Supporting publications (n) 26	Transmembrane count	Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins