EV MemProt Atlas

Basic Information11

Protein Names

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)

Protein Class (4)

EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000172531

Entrez Gene Symbol

PPP1CA

Gene Synonym (4)

PP-1APP1APP1alphaPPP1A

Gene Description

Protein phosphatase 1 catalytic subunit alpha

Chromosome

11

Position

67398181-67421183

Supporting publications (n)

26

EVMP confidence score

0.75

Fluorescence & Localization6

Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme

Function & Pathway8

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (15)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (23)

Page 1 of 3

Reactome (21)

Page 1 of 3

Canonical Pathways

M200 Pid era genomic pathway

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence133

Enzyme-Mediated Modification (27)

27 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PPP1CA	CDK1	P06493	T	320	phosphorylation	SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 phosphoELM:9122166 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491 KEA:10880350
PPP1CA	CDK1	P06493	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	320	phosphorylation	BEL-Large-Corpus_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:15212693 ProtMapper:16550609 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:17570479 KEA:9122166 ProtMapper:12202491 KEA:10880350 ProtMapper:14715909
PPP1CA	CDK5	Q00535	T	320	phosphorylation	SIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 SIGNOR:17202132 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491
PPP1CA	CDK5	Q00535	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	LMTK2	Q8IWU2	T	320	phosphorylation	SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:12393858 ProtMapper:12393858
PPP1CA	LMTK2	Q8IWU2	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	AKT1	P31749	T	320	phosphorylation	SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper	ProtMapper:17202132 ProtMapper:12202491
PPP1CA	AKT1	P31749	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 1 of 3Next

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (44)

44 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PP1A	P62136	TIF1B	Q13263	Yes	Yes	No	SPIKESPIKE_LCSIGNOR	SPIKE:20424263 SPIKE_LC:20424263 SIGNOR:20424263
PPR1B	Q9UD71	PP1A	P62136	Yes	No	Yes	WangNetPathSIGNORHPRDLMPIDSPIKE_LCSPIKE	LMPID:9108011 LMPID:10075680 HPRD:9108011 SPIKE:11440854 SPIKE_LC:11440854 LMPID:16428298 NetPath:19651774 SIGNOR:10604473
SMAD7	O15105	PP1A	P62136	Yes	Yes	No	WangSIGNORSignaLink3	SignaLink3:16571110 SignaLink3:23331499 SIGNOR:16571110
PP1A	P62136	ACVL1	P37023	Yes	Yes	No	WangSignaLink3	SignaLink3:16571110 SignaLink3:23331499
LMTK2	Q8IWU2	PP1A	P62136	Yes	Yes	Yes	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperHINTSignaLink3SIGNOR_ProtMapperLit-BM-17PhosphoSitePhosphoSite_ProtMapperSPIKE_LC	PhosphoSite:17283141 ProtMapper:12393858 SignaLink3:12393858 Lit-BM-17:12393858 PhosphoSite:16785988 SIGNOR:12393858 PhosphoSite:35081344 PhosphoSite:17202132 PhosphoSite:12202491 HINT:28065597 PhosphoSite:18250156 SignaLink3:23331499 HINT:12393858 SPIKE_LC:12393858 PhosphoSite:29764992 PhosphoSite:24120663
IPP2	P41236	PP1A	P62136	Yes	No	Yes	LMPIDSIGNORHPRDHINTIntActDIPLit-BM-17	DIP:20826336 IntAct:22321011 Lit-BM-17:26186194 Lit-BM-17:27173435 HINT:28330616 HINT:10807923 HINT:20826336 HINT:22321011 IntAct:10807923 IntAct:20826336 SIGNOR:18250156 Lit-BM-17:28330616 HINT:25593058 LMPID:16428298 HPRD:10807923 Lit-BM-17:22321011 Lit-BM-17:10807923 HINT:33961781
PP1A	P62136	AXIN1	O15169	Yes	No	Yes	SIGNORProtMapperDEPODACSNSIGNOR_ProtMapperHPRD-phosSPIKE_LC	HPRD-phos:17318175 SIGNOR:17318175 ACSN:17318175 SPIKE_LC:17318175 DEPOD:17318175 ProtMapper:17318175
PP1A	P62136	NOS3	P29474	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	ProtMapper:19036824 SIGNOR:19036824 DEPOD:19036824
PP1A	P62136	CASP9	P55211	Yes	Yes	No	SIGNORProtMapperDEPODACSNSIGNOR_ProtMapper	ProtMapper:16888006 SIGNOR:22311969 SIGNOR:16888006 ACSN:16888006 ACSN:12792650 ProtMapper:22311969 DEPOD:16888006
PP1A	P62136	PREX1	Q8TCU6	Yes	Yes	No	SIGNOR	SIGNOR:22242915

Page 1 of 5Next

Protein Complex Composition (56)

56 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ASH2L CXXC1 DPY30 H3-4 H3C15 HCFC1 HSPA8 PPP1CA PPP1R3B RBBP5 SETD1A SETD1B UBC WDR5 WDR82	O15047 P0CG48 P11142 P51610 P61964 P62136 Q15291 Q16695 Q6UXN9 Q71DI3 Q86XI6 Q9C005 Q9P0U4 Q9UBL3 Q9UPS6	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3931
CDK4 HCFC1 KAT8 OGT PAPOLA PPP1CA PPP1CB	O15294 P11802 P51003 P51610 P62136 P62140 Q9H7Z6	0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_542
BAD BAX BBC3 BCL2 BCL2L1 BCL2L10 BCL2L11 BECN1 MAPK8 MCL1 PPP1CA UBC VDAC1	O43521 P0CG48 P10415 P21796 P45983 P62136 Q07812 Q07817 Q07820 Q14457 Q92934 Q9BXH1 Q9HD36	1:1:1:1:1:1:1:1:1:1:1:1:1	CompleatCFinder	Compleat:HC8728
DLGAP5 PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R11 PPP1R15A PPP1R2 RPL35A	O60927 O75807 P18077 P36873 P41236 P62136 P62140 Q15398 Q96QC0	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5420
PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R11 PPP1R15A PPP1R2 YLPM1 ZNF341	O60927 O75807 P36873 P41236 P49750 P62136 P62140 Q96QC0 Q9BYN7	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5653
KMT2A PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R11 PPP1R15A PPP1R2 SMARCB1	O60927 O75807 P36873 P41236 P62136 P62140 Q03164 Q12824 Q96QC0	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4930
PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R11 PPP1R15A PPP1R2 ZFYVE16	O60927 O75807 P36873 P41236 P62136 P62140 Q7Z3T8 Q96QC0	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5113
PPP1CA PPP1CB PPP1R11 PPP1R2 PPP1R7 PUM2	O60927 P41236 P62136 P62140 Q15435 Q8TB72	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3743
PPP1CA PPP1R11	O60927 P62136	2:2	PDB	PDB:8dwlPDB:8dwk
PPP1CA PPP1R11 PPP1R7	O60927 P62136 Q15435	1:1:1	PDB	PDB:8u5g

Page 3 of 6Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30379855

Sequence, Structure & Domains12

Sequences

Length

330

Mass

37,512

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754

Alternative Sequence

18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)

3D Structural Models

Turn

23..25; 115..117; 132..135; 166..168; 259..262

Helix

9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274

Beta Strand

51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297

3D Structure

Electron microscopy (2); X-ray crystallography (43)

Domain & Motif Annotations

Region

306..330; Disordered

Protein Families (2)

PPP phosphatase family
PP-1 subfamily

Sequence Similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Clinical Relevance8

Related Diseases

Molluscum contagiosum

Biomarker

Approved

Drug Targets

Successful target

Drugs (5)

OKADAIC ACID CANTHARIDIN MICROCYSTIN-LR CHEMBL:CHEMBL1503729 DEMETHYL-CANTHARIDIN

Antibody (2)

CAB004545 HPA046833

Interaction Protein (57)

ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667

Interaction Count

57

Interaction Dataset (2)

intact_biogridintact_biogrid_bioplex

Supporting Publications26

PMID	Title	Abstract
26826536	[Cardiovascular risk study in patients with renin-angiotensin system blockade by means of the proteone of circulating extracellular vesicles].	No abstract available
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No abstract available
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
32916986	Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines.	No abstract available
33304478	The proteomic landscape of small urinary extracellular vesicles during kidney transplantation.	No abstract available
33592500	A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia.	No abstract available
34064677	Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells.	No abstract available
34473505	Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles.	No abstract available
34576246	Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.	No abstract available

Page 1 of 3Next

Entry name PP1A	UniProt ID P62136	EVMP confidence score 0.75
Supporting publications (n) 26	Transmembrane count	Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins