EV MemProt Atlas

Basic Information11

Protein Names

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)

Protein Class (4)

EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000172531

Entrez Gene Symbol

PPP1CA

Gene Synonym (4)

PP-1APP1APP1alphaPPP1A

Gene Description

Protein phosphatase 1 catalytic subunit alpha

Chromosome

11

Position

67398181-67421183

Supporting publications (n)

26

EVMP confidence score

0.75

Fluorescence & Localization6

Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme

Function & Pathway8

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (15)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (23)

Page 1 of 3

Reactome (21)

Page 1 of 3

Canonical Pathways

M200 Pid era genomic pathway

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence133

Enzyme-Mediated Modification (27)

27 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PPP1CA	CDK12	Q9NYV4	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK16	Q00536	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK17	Q00537	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK18	Q07002	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK20	Q8IZL9	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	GSK3B	P49841	T	320	phosphorylation	KEA	KEA:17570479
PPP1CA	PRKCA	P17252	S	325	phosphorylation	KEA	KEA:9399575

Page 3 of 3Previous

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (44)

44 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PP1A	P62136	TIF1B	Q13263	Yes	Yes	No	SPIKESPIKE_LCSIGNOR	SPIKE:20424263 SPIKE_LC:20424263 SIGNOR:20424263
PPR1B	Q9UD71	PP1A	P62136	Yes	No	Yes	WangNetPathSIGNORHPRDLMPIDSPIKE_LCSPIKE	LMPID:9108011 LMPID:10075680 HPRD:9108011 SPIKE:11440854 SPIKE_LC:11440854 LMPID:16428298 NetPath:19651774 SIGNOR:10604473
SMAD7	O15105	PP1A	P62136	Yes	Yes	No	WangSIGNORSignaLink3	SignaLink3:16571110 SignaLink3:23331499 SIGNOR:16571110
PP1A	P62136	ACVL1	P37023	Yes	Yes	No	WangSignaLink3	SignaLink3:16571110 SignaLink3:23331499
LMTK2	Q8IWU2	PP1A	P62136	Yes	Yes	Yes	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperHINTSignaLink3SIGNOR_ProtMapperLit-BM-17PhosphoSitePhosphoSite_ProtMapperSPIKE_LC	PhosphoSite:17283141 ProtMapper:12393858 SignaLink3:12393858 Lit-BM-17:12393858 PhosphoSite:16785988 SIGNOR:12393858 PhosphoSite:35081344 PhosphoSite:17202132 PhosphoSite:12202491 HINT:28065597 PhosphoSite:18250156 SignaLink3:23331499 HINT:12393858 SPIKE_LC:12393858 PhosphoSite:29764992 PhosphoSite:24120663
IPP2	P41236	PP1A	P62136	Yes	No	Yes	LMPIDSIGNORHPRDHINTIntActDIPLit-BM-17	DIP:20826336 IntAct:22321011 Lit-BM-17:26186194 Lit-BM-17:27173435 HINT:28330616 HINT:10807923 HINT:20826336 HINT:22321011 IntAct:10807923 IntAct:20826336 SIGNOR:18250156 Lit-BM-17:28330616 HINT:25593058 LMPID:16428298 HPRD:10807923 Lit-BM-17:22321011 Lit-BM-17:10807923 HINT:33961781
PP1A	P62136	AXIN1	O15169	Yes	No	Yes	SIGNORProtMapperDEPODACSNSIGNOR_ProtMapperHPRD-phosSPIKE_LC	HPRD-phos:17318175 SIGNOR:17318175 ACSN:17318175 SPIKE_LC:17318175 DEPOD:17318175 ProtMapper:17318175
PP1A	P62136	NOS3	P29474	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	ProtMapper:19036824 SIGNOR:19036824 DEPOD:19036824
PP1A	P62136	CASP9	P55211	Yes	Yes	No	SIGNORProtMapperDEPODACSNSIGNOR_ProtMapper	ProtMapper:16888006 SIGNOR:22311969 SIGNOR:16888006 ACSN:16888006 ACSN:12792650 ProtMapper:22311969 DEPOD:16888006
PP1A	P62136	PREX1	Q8TCU6	Yes	Yes	No	SIGNOR	SIGNOR:22242915

Page 1 of 5Next

Protein Complex Composition (56)

56 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
EIF2S1 KMT2A PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R15A PPP1R2 SMARCB1 ZFYVE16	O75807 P05198 P36873 P41236 P62136 P62140 Q03164 Q12824 Q7Z3T8 Q96QC0	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9055
DIRAS2 PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R15A PPP1R2 ZBTB16 ZFYVE16	O75807 P36873 P41236 P62136 P62140 Q05516 Q7Z3T8 Q96HU8 Q96QC0	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4518
PPP1CA PPP1R15A	O75807 P62136	2:2	PDB	PDB:4xpn
CCNB1 CDC14A CDC25C CDK1 HCFC1 MARK3 PKMYT1 PLK1 PPP1CA SLIT2 TSC1	O94813 P06493 P14635 P27448 P30307 P51610 P53350 P62136 Q92574 Q99640 Q9UNH5	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6544
HSPA4 PPP1CA PPP1R10 TERF2 TOX4	O94842 P34932 P62136 Q15554 Q96QC0	1:1:1:1:1	CompleatCFinder	Compleat:HC4241
CCNA2 CCNB1 CCNB2 CDK1 CDK2 CKS1B CKS2 DLG3 HCFC1 KLHDC3 PKMYT1 PPP1CA UBC	O95067 P06493 P0CG48 P14635 P20248 P24941 P33552 P51610 P61024 P62136 Q92796 Q99640 Q9BQ90	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5108
CCNB1 CCNB2 CDC25C CDK1 CDK2 HCFC1 HCFC2 MARK3 PKMYT1 PLK1 PPP1CA UBC WEE1	O95067 P06493 P0CG48 P14635 P24941 P27448 P30291 P30307 P51610 P53350 P62136 Q99640 Q9Y5Z7	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5576
PPP1CA RB1	P06400 P62136	1:2	PDB	PDB:3n5u
CDK1 HCFC1 HSPA4 HSPA8 KLHDC3 KMT2E MARK4 PPP1CA PPP1CB PPP1CC RIPK3 WDR82	P06493 P11142 P34932 P36873 P51610 P62136 P62140 Q6UXN9 Q8IZD2 Q96L34 Q9BQ90 Q9Y572	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5952
CDK1 HCFC1 HCFC2 HSPA4 KMT2E MARK4 PKMYT1 PPP1CA PPP1CC	P06493 P34932 P36873 P51610 P62136 Q8IZD2 Q96L34 Q99640 Q9Y5Z7	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4481

Page 4 of 6Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30379855

Sequence, Structure & Domains12

Sequences

Length

330

Mass

37,512

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754

Alternative Sequence

18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)

3D Structural Models

Turn

23..25; 115..117; 132..135; 166..168; 259..262

Helix

9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274

Beta Strand

51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297

3D Structure

Electron microscopy (2); X-ray crystallography (43)

Domain & Motif Annotations

Region

306..330; Disordered

Protein Families (2)

PPP phosphatase family
PP-1 subfamily

Sequence Similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Clinical Relevance8

Related Diseases

Molluscum contagiosum

Biomarker

Approved

Drug Targets

Successful target

Drugs (5)

OKADAIC ACID CANTHARIDIN MICROCYSTIN-LR CHEMBL:CHEMBL1503729 DEMETHYL-CANTHARIDIN

Antibody (2)

CAB004545 HPA046833

Interaction Protein (57)

ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667

Interaction Count

57

Interaction Dataset (2)

intact_biogridintact_biogrid_bioplex

Supporting Publications26

PMID	Title	Abstract
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No abstract available
40831280	Syntenin Controls Extracellular Vesicle-Induced Tumour Migration by Regulating the Expression of Adhesion Proteins on Small Extracellular Vesicles.	No abstract available
40840701	Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma.	No abstract available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available

Page 3 of 3Previous

Entry name PP1A	UniProt ID P62136	EVMP confidence score 0.75
Supporting publications (n) 26	Transmembrane count	Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins