EV MemProt Atlas

Basic Information11

Protein Names

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)

Protein Class (4)

EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000172531

Entrez Gene Symbol

PPP1CA

Gene Synonym (4)

PP-1APP1APP1alphaPPP1A

Gene Description

Protein phosphatase 1 catalytic subunit alpha

Chromosome

11

Position

67398181-67421183

Supporting publications (n)

26

EVMP confidence score

0.75

Fluorescence & Localization6

Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme

Function & Pathway8

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (15)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (23)

Page 1 of 3

Reactome (21)

Page 1 of 3

Canonical Pathways

M200 Pid era genomic pathway

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence133

Enzyme-Mediated Modification (27)

27 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
PPP1CA	CDK3	Q00526	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK10	Q15131	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK4	P11802	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK6	Q00534	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK7	P50613	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK8	P49336	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK11B	P21127	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK19	Q9BWU1	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK9	P50750	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK13	Q14004	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 2 of 3Previous Next

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (44)

44 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PP1A	P62136	SAHH2	O43865	Yes	No	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	DEPOD:17635105 ProtMapper:17635105 SIGNOR:17635105
PP1A	P62136	BRAF	P15056	Yes	Yes	No	SIGNOR	SIGNOR:29335436
PP1A	P62136	SP1	P08047	Yes	No	Yes	SIGNOR	SIGNOR:12684058
PP1A	P62136	MK03	P27361	Yes	No	Yes	HPRDSIGNOR	SIGNOR:12840032 HPRD:12624094
PP1A	P62136	PREX2	Q70Z35	Yes	Yes	No	SIGNOR	SIGNOR:26438819
PP1A	P62136	MECOM	Q03112	Yes	No	Yes	InnateDBSIGNOR	InnateDB:23858473 SIGNOR:23858473
PP1A	P62136	CASP2	P42575	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	SIGNOR:19531356 DEPOD:19531356 ProtMapper:19531356
PP1A	P62136	MDM2	Q00987	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:23277204 SIGNOR:23277204
PP1A	P62136	P53	P04637	Yes	No	Yes	SIGNORProtMapperDEPODHPRDSIGNOR_ProtMapperSPIKE_LC	DEPOD:16501611 ProtMapper:16501611 SPIKE_LC:15231748 DEPOD:15178317 HPRD:15231748 SPIKE_LC:16713569 SIGNOR:16501611
PP1A	P62136	AKT1	P31749	Yes	No	Yes	SIGNORProtMapperDEPODHINTSIGNOR_ProtMapper	DEPOD:14633703 ProtMapper:14633703 SIGNOR:20186153 ProtMapper:20186153 SIGNOR:14633703 HINT:14645548 HINT:20186153 HINT:11278544

Page 3 of 5Previous Next

Protein Complex Composition (56)

56 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
EIF2S1 KMT2A PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R15A PPP1R2 SMARCB1 ZFYVE16	O75807 P05198 P36873 P41236 P62136 P62140 Q03164 Q12824 Q7Z3T8 Q96QC0	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9055
DIRAS2 PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R15A PPP1R2 ZBTB16 ZFYVE16	O75807 P36873 P41236 P62136 P62140 Q05516 Q7Z3T8 Q96HU8 Q96QC0	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4518
PPP1CA PPP1R15A	O75807 P62136	2:2	PDB	PDB:4xpn
CCNB1 CDC14A CDC25C CDK1 HCFC1 MARK3 PKMYT1 PLK1 PPP1CA SLIT2 TSC1	O94813 P06493 P14635 P27448 P30307 P51610 P53350 P62136 Q92574 Q99640 Q9UNH5	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6544
HSPA4 PPP1CA PPP1R10 TERF2 TOX4	O94842 P34932 P62136 Q15554 Q96QC0	1:1:1:1:1	CompleatCFinder	Compleat:HC4241
CCNA2 CCNB1 CCNB2 CDK1 CDK2 CKS1B CKS2 DLG3 HCFC1 KLHDC3 PKMYT1 PPP1CA UBC	O95067 P06493 P0CG48 P14635 P20248 P24941 P33552 P51610 P61024 P62136 Q92796 Q99640 Q9BQ90	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5108
CCNB1 CCNB2 CDC25C CDK1 CDK2 HCFC1 HCFC2 MARK3 PKMYT1 PLK1 PPP1CA UBC WEE1	O95067 P06493 P0CG48 P14635 P24941 P27448 P30291 P30307 P51610 P53350 P62136 Q99640 Q9Y5Z7	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5576
PPP1CA RB1	P06400 P62136	1:2	PDB	PDB:3n5u
CDK1 HCFC1 HSPA4 HSPA8 KLHDC3 KMT2E MARK4 PPP1CA PPP1CB PPP1CC RIPK3 WDR82	P06493 P11142 P34932 P36873 P51610 P62136 P62140 Q6UXN9 Q8IZD2 Q96L34 Q9BQ90 Q9Y572	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5952
CDK1 HCFC1 HCFC2 HSPA4 KMT2E MARK4 PKMYT1 PPP1CA PPP1CC	P06493 P34932 P36873 P51610 P62136 Q8IZD2 Q96L34 Q99640 Q9Y5Z7	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4481

Page 4 of 6Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30379855

Sequence, Structure & Domains12

Sequences

Length

330

Mass

37,512

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754

Alternative Sequence

18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)

3D Structural Models

Turn

23..25; 115..117; 132..135; 166..168; 259..262

Helix

9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274

Beta Strand

51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297

3D Structure

Electron microscopy (2); X-ray crystallography (43)

Domain & Motif Annotations

Region

306..330; Disordered

Protein Families (2)

PPP phosphatase family
PP-1 subfamily

Sequence Similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Clinical Relevance8

Related Diseases

Molluscum contagiosum

Biomarker

Approved

Drug Targets

Successful target

Drugs (5)

OKADAIC ACID CANTHARIDIN MICROCYSTIN-LR CHEMBL:CHEMBL1503729 DEMETHYL-CANTHARIDIN

Antibody (2)

CAB004545 HPA046833

Interaction Protein (57)

ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667

Interaction Count

57

Interaction Dataset (2)

intact_biogridintact_biogrid_bioplex

Supporting Publications26

PMID	Title	Abstract
26826536	[Cardiovascular risk study in patients with renin-angiotensin system blockade by means of the proteone of circulating extracellular vesicles].	No abstract available
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No abstract available
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
32916986	Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines.	No abstract available
33304478	The proteomic landscape of small urinary extracellular vesicles during kidney transplantation.	No abstract available
33592500	A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia.	No abstract available
34064677	Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells.	No abstract available
34473505	Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles.	No abstract available
34576246	Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.	No abstract available

Page 1 of 3Next

Entry name PP1A	UniProt ID P62136	EVMP confidence score 0.75
Supporting publications (n) 26	Transmembrane count	Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins