EV MemProt Atlas

Basic Information11

Protein Names

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)

Protein Class (4)

EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000172531

Entrez Gene Symbol

PPP1CA

Gene Synonym (4)

PP-1APP1APP1alphaPPP1A

Gene Description

Protein phosphatase 1 catalytic subunit alpha

Chromosome

11

Position

67398181-67421183

Supporting publications (n)

26

EVMP confidence score

0.75

Fluorescence & Localization6

Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme

Function & Pathway8

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (15)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (23)

Page 1 of 3

Reactome (21)

Page 1 of 3

Canonical Pathways

M200 Pid era genomic pathway

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence133

Enzyme-Mediated Modification (27)

27 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PPP1CA	CDK1	P06493	T	320	phosphorylation	SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 phosphoELM:9122166 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491 KEA:10880350
PPP1CA	CDK1	P06493	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	320	phosphorylation	BEL-Large-Corpus_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:15212693 ProtMapper:16550609 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:17570479 KEA:9122166 ProtMapper:12202491 KEA:10880350 ProtMapper:14715909
PPP1CA	CDK5	Q00535	T	320	phosphorylation	SIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 SIGNOR:17202132 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491
PPP1CA	CDK5	Q00535	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	LMTK2	Q8IWU2	T	320	phosphorylation	SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:12393858 ProtMapper:12393858
PPP1CA	LMTK2	Q8IWU2	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	AKT1	P31749	T	320	phosphorylation	SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper	ProtMapper:17202132 ProtMapper:12202491
PPP1CA	AKT1	P31749	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 1 of 3Next

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (44)

44 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PP1A	P62136	SAHH2	O43865	Yes	No	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	DEPOD:17635105 ProtMapper:17635105 SIGNOR:17635105
PP1A	P62136	BRAF	P15056	Yes	Yes	No	SIGNOR	SIGNOR:29335436
PP1A	P62136	SP1	P08047	Yes	No	Yes	SIGNOR	SIGNOR:12684058
PP1A	P62136	MK03	P27361	Yes	No	Yes	HPRDSIGNOR	SIGNOR:12840032 HPRD:12624094
PP1A	P62136	PREX2	Q70Z35	Yes	Yes	No	SIGNOR	SIGNOR:26438819
PP1A	P62136	MECOM	Q03112	Yes	No	Yes	InnateDBSIGNOR	InnateDB:23858473 SIGNOR:23858473
PP1A	P62136	CASP2	P42575	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	SIGNOR:19531356 DEPOD:19531356 ProtMapper:19531356
PP1A	P62136	MDM2	Q00987	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:23277204 SIGNOR:23277204
PP1A	P62136	P53	P04637	Yes	No	Yes	SIGNORProtMapperDEPODHPRDSIGNOR_ProtMapperSPIKE_LC	DEPOD:16501611 ProtMapper:16501611 SPIKE_LC:15231748 DEPOD:15178317 HPRD:15231748 SPIKE_LC:16713569 SIGNOR:16501611
PP1A	P62136	AKT1	P31749	Yes	No	Yes	SIGNORProtMapperDEPODHINTSIGNOR_ProtMapper	DEPOD:14633703 ProtMapper:14633703 SIGNOR:20186153 ProtMapper:20186153 SIGNOR:14633703 HINT:14645548 HINT:20186153 HINT:11278544

Page 3 of 5Previous Next

Protein Complex Composition (56)

56 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CDK1 HCFC1 HCFC2 HSPA4 MARK4 PKMYT1 PPP1CA PRKG1	P06493 P34932 P51610 P62136 Q13976 Q96L34 Q99640 Q9Y5Z7	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9506
CDK4 HCFC1 HSP90AA1 HSPA4 HSPA8 KLHDC10 MARK4 PPP1CA PPP1CC RIPK3 UBC WDR82	P07900 P0CG48 P11142 P11802 P34932 P36873 P51610 P62136 Q6PID8 Q6UXN9 Q96L34 Q9Y572	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5084
ASH2L CXXC1 H3-4 H3C11 HCFC1 HCFC2 HSPA4 HSPA8 PHF8 PPP1CA SPOCD1 WDR5 WDR82	P11142 P34932 P51610 P61964 P62136 P68431 Q16695 Q6UXN9 Q6ZMY3 Q9P0U4 Q9UBL3 Q9UPP1 Q9Y5Z7	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4938
PPP1CA PPP1CB PPP1CC PPP1R2 PPP1R8	P36873 P41236 P62136 P62140 Q12972	0:0:0:0:0	hu.MAP2
ADISSP CNST KIF18A PPP1CA PPP1CC PPP1R8 RIF1 YLPM1	P36873 P49750 P62136 Q12972 Q5UIP0 Q6PJW8 Q8NI77 Q9GZN8	0:0:0:0:0:0:0:0	hu.MAP
PPP1CA PPP1CB PPP1CC	P36873 P62136 P62140	0:0:0	KEGG-MEDICUS
ADISSP CNST CSRNP2 KIF18A PPP1CA PPP1CC PPP1R8 TANC2	P36873 P62136 Q12972 Q6PJW8 Q8NI77 Q9GZN8 Q9H175 Q9HCD6	0:0:0:0:0:0:0:0	hu.MAP
PPP1CA	P62136	2	PDB	PDB:6obuPDB:3e7bPDB:3e7aPDB:4movPDB:6obrPDB:8sw6PDB:4g9jPDB:6obsPDB:6alzPDB:6obq
PPP1CA PPP1R8	P62136 Q12972	4:4	PDB	PDB:3v4y
ADISSP KIF18A PPP1CA PPP1R8	P62136 Q12972 Q8NI77 Q9GZN8	0:0:0:0	hu.MAP

Page 5 of 6Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30379855

Sequence, Structure & Domains12

Sequences

Length

330

Mass

37,512

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754

Alternative Sequence

18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)

3D Structural Models

Turn

23..25; 115..117; 132..135; 166..168; 259..262

Helix

9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274

Beta Strand

51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297

3D Structure

Electron microscopy (2); X-ray crystallography (43)

Domain & Motif Annotations

Region

306..330; Disordered

Protein Families (2)

PPP phosphatase family
PP-1 subfamily

Sequence Similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Clinical Relevance8

Related Diseases

Molluscum contagiosum

Biomarker

Approved

Drug Targets

Successful target

Drugs (5)

OKADAIC ACID CANTHARIDIN MICROCYSTIN-LR CHEMBL:CHEMBL1503729 DEMETHYL-CANTHARIDIN

Antibody (2)

CAB004545 HPA046833

Interaction Protein (57)

ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667

Interaction Count

57

Interaction Dataset (2)

intact_biogridintact_biogrid_bioplex

Supporting Publications26

PMID	Title	Abstract
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No abstract available
40831280	Syntenin Controls Extracellular Vesicle-Induced Tumour Migration by Regulating the Expression of Adhesion Proteins on Small Extracellular Vesicles.	No abstract available
40840701	Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma.	No abstract available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available

Page 3 of 3Previous

Entry name PP1A	UniProt ID P62136	EVMP confidence score 0.75
Supporting publications (n) 26	Transmembrane count	Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins