EV MemProt Atlas

Basic Information11

Protein Names

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)

Protein Class (4)

EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000172531

Entrez Gene Symbol

PPP1CA

Gene Synonym (4)

PP-1APP1APP1alphaPPP1A

Gene Description

Protein phosphatase 1 catalytic subunit alpha

Chromosome

11

Position

67398181-67421183

Supporting publications (n)

26

EVMP confidence score

0.75

Fluorescence & Localization6

Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme

Function & Pathway8

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (15)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (23)

Page 1 of 3

Reactome (21)

Page 1 of 3

Canonical Pathways

M200 Pid era genomic pathway

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence133

Enzyme-Mediated Modification (27)

27 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PPP1CA	CDK1	P06493	T	320	phosphorylation	SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 phosphoELM:9122166 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491 KEA:10880350
PPP1CA	CDK1	P06493	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	320	phosphorylation	BEL-Large-Corpus_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:15212693 ProtMapper:16550609 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:17570479 KEA:9122166 ProtMapper:12202491 KEA:10880350 ProtMapper:14715909
PPP1CA	CDK5	Q00535	T	320	phosphorylation	SIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 SIGNOR:17202132 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491
PPP1CA	CDK5	Q00535	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	LMTK2	Q8IWU2	T	320	phosphorylation	SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:12393858 ProtMapper:12393858
PPP1CA	LMTK2	Q8IWU2	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	AKT1	P31749	T	320	phosphorylation	SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper	ProtMapper:17202132 ProtMapper:12202491
PPP1CA	AKT1	P31749	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 1 of 3Next

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (44)

44 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PP1R8	Q12972	PP1A	P62136	Yes	No	Yes	LMPIDSIGNORHPRDHINTHuRIIntActDIPSPIKE_LCLit-BM-17	Lit-BM-17:12788942 IntAct:22940584 IntAct:32296183 SPIKE_LC:15231748 HINT:25593058 HINT:22940584 SPIKE_LC:16189514 IntAct:22365833 IntAct:18842582 Lit-BM-17:15231748 LMPID:9353294 HINT:10637318 HINT:12788942 Lit-BM-17:27173435 DIP:22940584 Lit-BM-17:26186194 HINT:18842582 Lit-BM-17:18842582 Lit-BM-17:20516061 Lit-BM-17:28330616 HINT:33961781 LMPID:20044954 Lit-BM-17:10637318 Lit-BM-17:20671031 Lit-BM-17:22365833 SIGNOR:1322907 HINT:28330616 HPRD:15231748 LMPID:12657641 IntAct:15231748
SHOC2	Q9UQ13	PP1A	P62136	Yes	Yes	No	HINTSIGNOR	HINT:35831509 HINT:35830882 HINT:36175670 SIGNOR:16630891 HINT:33961781
PP1A	P62136	STAT3	P40763	Yes	No	Yes	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:19440292 SIGNOR:19440292
PP1A	P62136	RAF1	P04049	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	ProtMapper:16630891 SIGNOR:16630891 DEPOD:7604263
CDK1	P06493	PP1A	P62136	Yes	No	Yes	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAKinexus_KEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperLit-BM-17PhosphoSite_ProtMapperSPIKE_LC	phosphoELM:9122166 SPIKE_LC:17145710 KEA:18088087 KEA:97225924 Lit-BM-17:17274640 KEA:12202491 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491 KEA:10880350
PP1A	P62136	IFIH1	Q9BYX4	Yes	Yes	No	InnateDBSIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:23499489 ProtMapper:23499489 InnateDB:23499489
PP1A	P62136	MK01	P28482	Yes	No	Yes	HPRDSIGNOR	SIGNOR:12840032 HPRD:12624094
PP1A	P62136	CCND3	P30281	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:16331257 SIGNOR:16331257
PP1A	P62136	PROF1	P07737	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:22479341 ProtMapper:22479341
PP1A	P62136	AURKA	O14965	Yes	No	Yes	HPRDSIGNORDEPOD	SIGNOR:11551964 DEPOD:11039908 HPRD:11551964

Page 4 of 5Previous Next

Protein Complex Composition (56)

56 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
PPP1CA TP53BP2	P62136 Q13625	2:2	PDB	PDB:6ghm
PPP1CA RRP1B	P62136 Q14684	2:2	PDB	PDB:7t0y
PPP1CA PPP1R7	P62136 Q15435	2:2	PDB	PDB:6obnPDB:6obp
CDCA2 PPP1CA	P62136 Q69YH5	2:2	PDB	PDB:5ioh
KNL1 PPP1CA	P62136 Q8NG31	2:2	PDB	PDB:6czo
PPP1CA PPP1R3C	P62136 Q9UQK1	2:2	PDB	PDB:7qm2PDB:7qfb

Page 6 of 6Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30379855

Sequence, Structure & Domains12

Sequences

Length

330

Mass

37,512

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754

Alternative Sequence

18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)

3D Structural Models

Turn

23..25; 115..117; 132..135; 166..168; 259..262

Helix

9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274

Beta Strand

51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297

3D Structure

Electron microscopy (2); X-ray crystallography (43)

Domain & Motif Annotations

Region

306..330; Disordered

Protein Families (2)

PPP phosphatase family
PP-1 subfamily

Sequence Similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Clinical Relevance8

Related Diseases

Molluscum contagiosum

Biomarker

Approved

Drug Targets

Successful target

Drugs (5)

OKADAIC ACID CANTHARIDIN MICROCYSTIN-LR CHEMBL:CHEMBL1503729 DEMETHYL-CANTHARIDIN

Antibody (2)

CAB004545 HPA046833

Interaction Protein (57)

ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667

Interaction Count

57

Interaction Dataset (2)

intact_biogridintact_biogrid_bioplex

Supporting Publications26

PMID	Title	Abstract
26826536	[Cardiovascular risk study in patients with renin-angiotensin system blockade by means of the proteone of circulating extracellular vesicles].	No abstract available
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No abstract available
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
32916986	Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines.	No abstract available
33304478	The proteomic landscape of small urinary extracellular vesicles during kidney transplantation.	No abstract available
33592500	A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia.	No abstract available
34064677	Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells.	No abstract available
34473505	Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles.	No abstract available
34576246	Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.	No abstract available

Page 1 of 3Next

Entry name PP1A	UniProt ID P62136	EVMP confidence score 0.75
Supporting publications (n) 26	Transmembrane count	Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins