EV MemProt Atlas

Basic Information11

Protein Names

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)

Protein Class (4)

EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000172531

Entrez Gene Symbol

PPP1CA

Gene Synonym (4)

PP-1APP1APP1alphaPPP1A

Gene Description

Protein phosphatase 1 catalytic subunit alpha

Chromosome

11

Position

67398181-67421183

Supporting publications (n)

26

EVMP confidence score

0.75

Fluorescence & Localization6

Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme

Function & Pathway8

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (15)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (23)

Page 1 of 3

Reactome (21)

Page 1 of 3

Canonical Pathways

M200 Pid era genomic pathway

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence133

Enzyme-Mediated Modification (27)

27 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PPP1CA	CDK1	P06493	T	320	phosphorylation	SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 phosphoELM:9122166 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491 KEA:10880350
PPP1CA	CDK1	P06493	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	CDK2	P24941	T	320	phosphorylation	BEL-Large-Corpus_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:15212693 ProtMapper:16550609 KEA:18088087 KEA:97225924 KEA:12202491 SIGNOR:12202491 KEA:17570479 KEA:9122166 ProtMapper:12202491 KEA:10880350 ProtMapper:14715909
PPP1CA	CDK5	Q00535	T	320	phosphorylation	SIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17202132 SIGNOR:17202132 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491
PPP1CA	CDK5	Q00535	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	LMTK2	Q8IWU2	T	320	phosphorylation	SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:12393858 ProtMapper:12393858
PPP1CA	LMTK2	Q8IWU2	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
PPP1CA	AKT1	P31749	T	320	phosphorylation	SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper	ProtMapper:17202132 ProtMapper:12202491
PPP1CA	AKT1	P31749	T	331	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 1 of 3Next

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (44)

44 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PP1R8	Q12972	PP1A	P62136	Yes	No	Yes	LMPIDSIGNORHPRDHINTHuRIIntActDIPSPIKE_LCLit-BM-17	Lit-BM-17:12788942 IntAct:22940584 IntAct:32296183 SPIKE_LC:15231748 HINT:25593058 HINT:22940584 SPIKE_LC:16189514 IntAct:22365833 IntAct:18842582 Lit-BM-17:15231748 LMPID:9353294 HINT:10637318 HINT:12788942 Lit-BM-17:27173435 DIP:22940584 Lit-BM-17:26186194 HINT:18842582 Lit-BM-17:18842582 Lit-BM-17:20516061 Lit-BM-17:28330616 HINT:33961781 LMPID:20044954 Lit-BM-17:10637318 Lit-BM-17:20671031 Lit-BM-17:22365833 SIGNOR:1322907 HINT:28330616 HPRD:15231748 LMPID:12657641 IntAct:15231748
SHOC2	Q9UQ13	PP1A	P62136	Yes	Yes	No	HINTSIGNOR	HINT:35831509 HINT:35830882 HINT:36175670 SIGNOR:16630891 HINT:33961781
PP1A	P62136	STAT3	P40763	Yes	No	Yes	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:19440292 SIGNOR:19440292
PP1A	P62136	RAF1	P04049	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapperDEPOD	ProtMapper:16630891 SIGNOR:16630891 DEPOD:7604263
CDK1	P06493	PP1A	P62136	Yes	No	Yes	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAKinexus_KEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperLit-BM-17PhosphoSite_ProtMapperSPIKE_LC	phosphoELM:9122166 SPIKE_LC:17145710 KEA:18088087 KEA:97225924 Lit-BM-17:17274640 KEA:12202491 SIGNOR:12202491 KEA:9122166 ProtMapper:12202491 KEA:10880350
PP1A	P62136	IFIH1	Q9BYX4	Yes	Yes	No	InnateDBSIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:23499489 ProtMapper:23499489 InnateDB:23499489
PP1A	P62136	MK01	P28482	Yes	No	Yes	HPRDSIGNOR	SIGNOR:12840032 HPRD:12624094
PP1A	P62136	CCND3	P30281	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	ProtMapper:16331257 SIGNOR:16331257
PP1A	P62136	PROF1	P07737	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:22479341 ProtMapper:22479341
PP1A	P62136	AURKA	O14965	Yes	No	Yes	HPRDSIGNORDEPOD	SIGNOR:11551964 DEPOD:11039908 HPRD:11551964

Page 4 of 5Previous Next

Protein Complex Composition (56)

56 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Gac1p/Glc7p complex	PPP1CA PPP1CB PPP1CC PPP1R3A PPP1R3B PPP1R3C PPP1R3D	O95685 P36873 P62136 P62140 Q16821 Q86XI6 Q9UQK1	1:1:1:1:1:1:1	Compleat	Compleat:HC1708	11459182
HDAC1-PP1	HDAC1 HDAC2 PPP1CA PPP1R10 PPP2R5A PPP4C	P60510 P62136 Q13547 Q15172 Q92769 Q96QC0	1:1:1:1:1:1	Compleat	Compleat:HC2286	12567184
HT_DM_Cluster26	PPP1CA PPP1CB PPP1CC PPP1R11 PPP1R2 PPP1R7 PPP1R8 VAMP1	O60927 P23763 P36873 P41236 P62136 P62140 Q12972 Q15435	1:1:1:1:1:1:1:1	Compleat	Compleat:HC3405	22036573
HT_SC_Cluster95	PPCDC PPP1CA	P62136 Q96CD2	1:1	Compleat	Compleat:HC1545
MLL5-L complex	ACTB HCFC1 KMT2E OGT PPP1CA PPP1CB PPP1CC STK38	O15294 P36873 P51610 P60709 P62136 P62140 Q15208 Q8IZD2	1:1:1:1:1:1:1:1	Compleat	Compleat:HC887	19377461
PNUTS-PP1 complex	PPP1CA PPP1R10	P62136 Q96QC0	2:2	CompleatCORUMPDB	Compleat:HC2639CORUM:180PDB:8sw5	12574161
PPP1CA-PPP1R13L complex	PPP1CA PPP1R13L	P62136 Q8WUF5	2:2	CORUMPDB	CORUM:7423PDB:6dcx	21998301
PTW/PP1 phosphatase complex	PPP1CA PPP1CB PPP1CC PPP1R10 PPP1R12A TOX4 WDR82	O14974 O94842 P36873 P62136 P62140 Q6UXN9 Q96QC0	1:1:1:1:1:1:1	Compleat	Compleat:HC3130
SHOC2-HRAS-PPP1CA complex	HRAS PPP1CA SHOC2	P01112 P62136 Q9UQ13	1:1:1	ComplexPortal	intact:EBI-61184387	36175670 35768504 35831509 14755292 35830882
SHOC2-KRAS-PPP1CA complex	KRAS PPP1CA SHOC2	P01116 P62136 Q9UQ13	1:1:1	ComplexPortal	intact:EBI-61184731	36175670 35831509 35768504 14755292 35830882 28162770

Page 1 of 6Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30379855

Sequence, Structure & Domains12

Sequences

Length

330

Mass

37,512

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754

Alternative Sequence

18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)

3D Structural Models

Turn

23..25; 115..117; 132..135; 166..168; 259..262

Helix

9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274

Beta Strand

51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297

3D Structure

Electron microscopy (2); X-ray crystallography (43)

Domain & Motif Annotations

Region

306..330; Disordered

Protein Families (2)

PPP phosphatase family
PP-1 subfamily

Sequence Similarities

Belongs to the PPP phosphatase family. PP-1 subfamily.

Clinical Relevance8

Related Diseases

Molluscum contagiosum

Biomarker

Approved

Drug Targets

Successful target

Drugs (5)

OKADAIC ACID CANTHARIDIN MICROCYSTIN-LR CHEMBL:CHEMBL1503729 DEMETHYL-CANTHARIDIN

Antibody (2)

CAB004545 HPA046833

Interaction Protein (57)

ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667

Interaction Count

57

Interaction Dataset (2)

intact_biogridintact_biogrid_bioplex

Supporting Publications26

PMID	Title	Abstract
36064647	Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells.	No abstract available
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available
36497184	Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells.	No abstract available
37204515	Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
37926756	Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
39207047	The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available

Page 2 of 3Previous Next

Entry name PP1A	UniProt ID P62136	EVMP confidence score 0.75
Supporting publications (n) 26	Transmembrane count	Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins