Protein detail
PP1A
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)
Entry name PP1A | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 26 | Transmembrane count | Protein classification EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)
Protein Class (4)
EnzymesEssential proteinsPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
PP-1APP1APP1alphaPPP1A
Gene Description
Protein phosphatase 1 catalytic subunit alpha
Chromosome
11
Position
67398181-67421183
Supporting publications (n)
26
EVMP confidence score
0.75
Fluorescence & Localization6
Tissue SpecificcervixCell SpecificAdrenal cortex cellsBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionEnzyme
Function & Pathway8
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Cellular Component (15)
- GO:0000781 chromosome, telomeric region
- GO:0005634 nucleus
- GO:0005654 nucleoplasm
- GO:0005730 nucleolus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005912 adherens junction
- GO:0042587 glycogen granule
- GO:0043197 dendritic spine
Page 1 of 2
Molecular Function (10)
- GO:0004721 phosphoprotein phosphatase activity
- GO:0004722 protein serine/threonine phosphatase activity
- GO:0005506 iron ion binding
- GO:0005515 protein binding
- GO:0008157 protein phosphatase 1 binding
- GO:0016791 phosphatase activity
- GO:0017018 myosin phosphatase activity
- GO:0043021 ribonucleoprotein complex binding
- GO:0046914 transition metal ion binding
- GO:0098641 cadherin binding involved in cell-cell adhesion
Biological Process (3)
KEGG (23)
- hsa03015 mRNA surveillance pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04114 Oocyte meiosis
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04390 Hippo signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04519 Cadherin signaling
Page 1 of 3
Reactome (21)
- R-hsa-9909396 circadian clock
- R-hsa-180024 darpp 32 events
- R-hsa-2173788 downregulation of tgf beta receptor signaling
- R-hsa-418594 g alpha i signalling events
- R-hsa-5663205 infectious disease
- R-hsa-556833 metabolism of lipids
- R-hsa-8953854 metabolism of rna
- R-hsa-72187 mrna 3 end processing
- R-hsa-9770562 mrna polyadenylation
- R-hsa-111885 opioid signalling
Page 1 of 3
Canonical Pathways
M200 Pid era genomic pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence133
Enzyme-Mediated Modification (27)
27 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PPP1CA | CDK1 | P06493 | T | 320 | phosphorylation | SIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:17202132phosphoELM:9122166KEA:18088087KEA:97225924KEA:12202491SIGNOR:12202491KEA:9122166ProtMapper:12202491KEA:10880350 |
| PPP1CA | CDK1 | P06493 | T | 331 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PPP1CA | CDK2 | P24941 | T | 331 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PPP1CA | CDK2 | P24941 | T | 320 | phosphorylation | BEL-Large-Corpus_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:15212693ProtMapper:16550609KEA:18088087KEA:97225924KEA:12202491SIGNOR:12202491KEA:17570479KEA:9122166ProtMapper:12202491KEA:10880350ProtMapper:14715909 |
| PPP1CA | CDK5 | Q00535 | T | 320 | phosphorylation | SIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:17202132SIGNOR:17202132SIGNOR:12202491KEA:9122166ProtMapper:12202491 |
| PPP1CA | CDK5 | Q00535 | T | 331 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PPP1CA | LMTK2 | Q8IWU2 | T | 320 | phosphorylation | SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:12393858ProtMapper:12393858 |
| PPP1CA | LMTK2 | Q8IWU2 | T | 331 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PPP1CA | AKT1 | P31749 | T | 320 | phosphorylation | SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:17202132ProtMapper:12202491 |
| PPP1CA | AKT1 | P31749 | T | 331 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP |
Page 1 of 3Next
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (44)
44 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PP1A | P62136 | YAP1 | P46937 | Yes | Yes | No | HINTSIGNOR | HINT:24255178SIGNOR:21909427HINT:24366813 |
| CDK5 | Q00535 | PP1A | P62136 | Yes | No | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperKEAKinexus_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:17202132SIGNOR:17202132SIGNOR:12202491KEA:9122166ProtMapper:12202491 |
| PP1A | P62136 | MPIP3 | P30307 | Yes | Yes | No | SIGNORDEPODKinexus_KEAKEAWang | SIGNOR:14592972KEA:11897663KEA:9543386DEPOD:16467385DEPOD:14592972 |
| PP1A | P62136 | GCR | P04150 | Yes | Yes | No | SIGNORSparser_ProtMapperProtMapper | ProtMapper:32585168SIGNOR:32585168 |
| PP1A | P62136 | BRCA1 | P38398 | Yes | No | Yes | SIGNORProtMapperDEPODHPRDHINTBioGRIDLMPIDSIGNOR_ProtMapperSPIKE_LC | HPRD:12438214HINT:17511879BioGRID:25056273SIGNOR:17603999ProtMapper:17603999DEPOD:12438214HINT:12438214SPIKE_LC:17511879HINT:29764992DEPOD:17603999LMPID:17603999 |
| PP1A | P62136 | SP3 | Q02447 | Yes | No | Yes | SIGNOR | SIGNOR:12684058 |
| CDK2 | P24941 | PP1A | P62136 | Yes | No | Yes | BEL-Large-Corpus_ProtMapperSparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_ProtMapperHPRD_MIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperPhosphoSite_KEAKEAphosphoELM_KEASIGNOR_ProtMapperLit-BM-17NetworKIN_KEASPIKE_LC | ProtMapper:30661852ProtMapper:15212693ProtMapper:16550609SPIKE_LC:17145710KEA:18088087KEA:97225924Lit-BM-17:17274640KEA:12202491SIGNOR:12202491KEA:17570479KEA:9122166ProtMapper:12202491KEA:10880350ProtMapper:14715909 |
| PP1A | P62136 | PYR1 | P27708 | Yes | No | Yes | SIGNORProtMapperDEPODHPRDSIGNOR_ProtMapper | SIGNOR:4092695ProtMapper:4092695HPRD:4092695DEPOD:4092695 |
| PP1A | P62136 | IKZF1 | Q13422 | Yes | Yes | No | SIGNORDEPOD | DEPOD:19282287SIGNOR:21750978 |
| PP1A | P62136 | WWTR1 | Q9GZV5 | Yes | Yes | No | SIGNOR | SIGNOR:21189257 |
Protein Complex Composition (56)
56 records.
Page 1 of 6Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30379855 |
Sequence, Structure & Domains12
Sequences
Length
330
Mass
37,512
Sequence
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P62136-1; Sequence=Displayed; Name=2; IsoId=P62136-2; Sequence=VSP_043377; Name=3; IsoId=P62136-3; Sequence=VSP_046754
Alternative Sequence
18; E -> EGSRVLTPHCAP (in isoform 2); 19..62; Missing (in isoform 3)
3D Structural Models
Turn
23..25; 115..117; 132..135; 166..168; 259..262
Helix
9..18; 19..21; 32..48; 69..79; 100..113; 124..126; 128..131; 136..143; 146..156; 183..187; 200..206; 229..239; 272..274
Beta Strand
51..55; 57..62; 87..89; 94..98; 118..120; 162..165; 169..171; 197..199; 214..218; 222..227; 242..246; 248..251; 254..258; 263..267; 280..285; 290..297
3D Structure
Electron microscopy (2); X-ray crystallography (43)
Domain & Motif Annotations
Region
306..330; Disordered
Protein Families (2)
- PPP phosphatase family
- PP-1 subfamily
Sequence Similarities
Belongs to the PPP phosphatase family. PP-1 subfamily.
Clinical Relevance8
Related Diseases
Biomarker
Approved
Drug Targets
Successful target
Interaction Protein (57)
ENSG00000005175ENSG00000010017ENSG00000012048ENSG00000039068ENSG00000039319ENSG00000080345ENSG00000084463ENSG00000087074ENSG00000087495ENSG00000088356ENSG00000088808ENSG00000096401ENSG00000099817ENSG00000101220ENSG00000101367ENSG00000101445ENSG00000104812ENSG00000104866ENSG00000104872ENSG00000104881ENSG00000105176ENSG00000108061ENSG00000108819ENSG00000110925ENSG00000115685ENSG00000117751ENSG00000119596ENSG00000119938ENSG00000121621ENSG00000124214ENSG00000124383ENSG00000126756ENSG00000132825ENSG00000137812ENSG00000139687ENSG00000142208ENSG00000143514ENSG00000144655ENSG00000146112ENSG00000154822ENSG00000156463ENSG00000157077ENSG00000158615ENSG00000160208ENSG00000162852ENSG00000166068ENSG00000169217ENSG00000173281ENSG00000176058ENSG00000181409ENSG00000184203ENSG00000186298ENSG00000204569ENSG00000204619ENSG00000213639ENSG00000235194ENSG00000243667
Interaction Count
57
Interaction Dataset (2)
intact_biogridintact_biogrid_bioplex
Supporting Publications26
| PMID | Title | Abstract |
|---|---|---|
| 40465195 | Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome. | No abstract available |
| 40831280 | Syntenin Controls Extracellular Vesicle-Induced Tumour Migration by Regulating the Expression of Adhesion Proteins on Small Extracellular Vesicles. | No abstract available |
| 40840701 | Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma. | No abstract available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No abstract available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |
Page 3 of 3Previous