Protein detail
UB2D2
Ubiquitin-conjugating enzyme E2 D2 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D2) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2(17)KB 2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (Ubiquitin-protein ligase D2) (p53-regulated ubiquitin-conjugating enzyme 1)
Protein symbol UB2D2 | UniProt ID | EVMP score 0.50 |
Frequency 9 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteinsTransporters |
Basic Information
Protein Names
Ubiquitin-conjugating enzyme E2 D2 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D2) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2(17)KB 2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (Ubiquitin-protein ligase D2) (p53-regulated ubiquitin-conjugating enzyme 1)
Protein Class
EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteinsTransporters
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
UBC4UbcH5B
Gene Description
Ubiquitin conjugating enzyme E2 D2
Chromosome
5
Position
139526431-139628434
Frequency
9
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecifictestisCell SpecificDifferentiating spermatogonia
Function & Pathway
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-983168 antigen processing ubiquitination proteasome degradation
- R-hsa-9612973 autophagy
- R-hsa-9824439 bacterial infection pathways
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1234174 cellular response to hypoxia
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-5607764 clec7a dectin 1 signaling
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-168928 ddx58 ifih1 mediated induction of interferon alpha beta
- R-hsa-73887 death receptor signaling
- R-hsa-202424 downstream tcr signaling
- R-hsa-8866654 e3 ubiquitin ligases ubiquitinate target proteins
- R-hsa-9956593 enterobacterial factors antagonize host defense
- R-hsa-2871837 fceri mediated nf kb activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-937041 ikk complex recruitment mediated by rip1
- R-hsa-9705462 inactivation of csf3 g csf signaling
- R-hsa-9640148 infection with enterobacteria
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-5205647 mitophagy
- R-hsa-166166 myd88 independent tlr4 cascade
- R-hsa-8951664 neddylation
- R-hsa-936440 negative regulators of ddx58 ifih1 signaling
- R-hsa-9033241 peroxisomal protein import
- R-hsa-5205685 pink1 prkn mediated mitophagy
- R-hsa-597592 post translational protein modification
- R-hsa-9609507 protein localization
- R-hsa-8852135 protein ubiquitination
- R-hsa-9948299 ribosome associated quality control
- R-hsa-9954709 ribosome quality control rqc complex extracts and degrades nascent peptide
- R-hsa-9663891 selective autophagy
- R-hsa-9674555 signaling by csf3 g csf
- R-hsa-8866652 synthesis of active ubiquitin roles of e1 and e2 enzymes
- R-hsa-202403 tcr signaling
- R-hsa-168927 ticam1 rip1 mediated ikk complex recruitment
- R-hsa-75893 tnf signaling
- R-hsa-168898 toll like receptor cascades
- R-hsa-72766 translation
Mediation Categories
Clinical-translation mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
17 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| UB2D2 | P62837 | TRI22 | Q8IYM9 | Yes | Yes | No | SIGNOR | SIGNOR:18656448 |
| UB2D2 | P62837 | PEX5 | P50542 | Yes | No | Yes | SIGNOR | SIGNOR:19687296 |
| UB2D2 | P62837 | TRIM5 | Q9C035 | Yes | Yes | No | HINTLit-BM-17SIGNORSPIKE_LC | HINT:18312418HINT:12878161Lit-BM-17:18312418SPIKE_LC:17145710SIGNOR:18312418Lit-BM-17:19549727Lit-BM-17:12878161 |
| UB2D2 | P62837 | COMPLEX:Q5XPI4_Q9BSL1 | Yes | Yes | No | SIGNOR | SIGNOR:15531880 | |
| UB2D2 | P62837 | PZRN3 | Q9UPQ7 | Yes | Yes | No | SIGNOR | SIGNOR:17576800 |
| PEX2 | P28328 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:19687296 |
| COMPLEX:A0AVT1_P0CG47 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P62979 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P0CG48 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P62987 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 |
Page 1 of 2Next
Protein Complex Composition
27 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| BIRC2UBBUBE2D2 | P0CG47P62837Q13490 | 2:1:1 | PDB | PDB:6hpr | ||
| RNF31UBBUBE2D2 | P0CG47P62837Q96EP0 | 4:3:2 | PDB | PDB:5edv | ||
| BTRCCUL1NEDD8NFKBIARBX1SKP1UBCUBE2D2 | P0CG48P25963P62837P62877P63208Q13616Q15843Q9Y297 | 1:1:1:1:1:1:1:1 | PDB | PDB:6ttu | ||
| CBLBUBCUBE2D2ZAP70 | P0CG48P43403P62837Q13191 | 4:4:4:4 | PDB | PDB:3zni | ||
| CDKN1BRCHY1UBCUBE2D2UBE3A | P0CG48P46527P62837Q05086Q96PM5 | 1:1:1:1:1 | CompleatCFinder | Compleat:HC6801 | ||
| CUL4ADDB1ERCC8NEDD8RBX1UBCUBE2D2 | P0CG48P62837P62877Q13216Q13619Q15843Q16531 | 1:1:1:1:1:1:1 | PDB | PDB:8b3i | ||
| BIRC7UBCUBE2D2 | P0CG48P62837Q96CA5 | 2:2:2 | PDB | PDB:4auq | ||
| RNF38UBCUBE2D2 | P0CG48P62837Q9H0F5 | 2:2:2 | PDB | PDB:4v3lPDB:4v3k | ||
| RLIMUBCUBE2D2 | P0CG48P62837Q9NVW2 | 3:3:3 | PDB | PDB:6w9d | ||
| ARF4SERPINB5UBE2D2 | P18085P36952P62837 | 0:0:0 | hu.MAP |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30915084 |
Sequence, Structure & Domains
Sequences
Length
147
Mass
16,735
Sequence
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P62837-1; Sequence=Displayed; Name=2; IsoId=P62837-2; Sequence=VSP_045180
Alternative Sequence
1..29; Missing (in isoform 2)
3D Structural Models
Turn
44..47; 58..61; 90..92
Helix
1..15; 87..89; 99..111; 121..129; 131..145
Beta Strand
19..28; 32..38; 41..43; 49..55; 66..71; 76..78; 82..84; 115..117
3D Structure
Electron microscopy (4); NMR spectroscopy (2); X-ray crystallography (52)
Domain & Motif Annotations
Domain (FT)
1..147; UBC core
Protein Families
Ubiquitin-conjugating enzyme family
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.
Clinical Relevance
Antibody
Interaction Protein
ENSG00000022840ENSG00000023445ENSG00000070423ENSG00000072609ENSG00000091073ENSG00000092098ENSG00000101871ENSG00000101966ENSG00000103266ENSG00000103429ENSG00000108375ENSG00000110395ENSG00000121481ENSG00000123091ENSG00000124226ENSG00000138100ENSG00000138942ENSG00000146755ENSG00000157450ENSG00000159461ENSG00000163481ENSG00000165886ENSG00000167770ENSG00000168411ENSG00000173456ENSG00000175104ENSG00000186187ENSG00000196470ENSG00000198625ENSG00000198919ENSG00000204227ENSG00000204308ENSG00000265491
Interaction Count
33
Interaction Dataset
intact_biogridintact_biogrid_bioplex