Protein detail
UB2D2
Ubiquitin-conjugating enzyme E2 D2 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D2) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2(17)KB 2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (Ubiquitin-protein ligase D2) (p53-regulated ubiquitin-conjugating enzyme 1)
Entry name UB2D2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 9 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Ubiquitin-conjugating enzyme E2 D2 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D2) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2(17)KB 2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (Ubiquitin-protein ligase D2) (p53-regulated ubiquitin-conjugating enzyme 1)
Protein Class (5)
EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteinsTransporters
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
UBC4UbcH5B
Gene Description
Ubiquitin conjugating enzyme E2 D2
Chromosome
5
Position
139526431-139628434
Supporting publications (n)
9
EVMP confidence score
0.50
Fluorescence & Localization2
Tissue SpecifictestisCell SpecificDifferentiating spermatogonia
Function & Pathway7
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (5)
Biological Process (3)
KEGG (4)
Reactome (41)
- R-hsa-1280218 adaptive immune system
- R-hsa-983168 antigen processing ubiquitination proteasome degradation
- R-hsa-9612973 autophagy
- R-hsa-9824439 bacterial infection pathways
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1234174 cellular response to hypoxia
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-5607764 clec7a dectin 1 signaling
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5621481 c type lectin receptors clrs
Page 1 of 5
Mediation Categories (4)
Clinical-translation mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence49
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (17)
17 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:P22314_P62979 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P22314_P62987 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG47_P22314 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG48_P22314 | UB2D2 | P62837 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| UB2D2 | P62837 | UBR5 | O95071 | Yes | Yes | No | HINTSIGNORBioGRID | HINT:23027739HINT:29643511BioGRID:37855385HINT:21127351SIGNOR:11714696HINT:33208877HINT:35980206HINT:11714696HINT:19287380BioGRID:35980206HINT:26949039 |
| UB2D2 | P62837 | TRIM9 | Q9C026 | Yes | Yes | No | SIGNOR | SIGNOR:20085810 |
| UB2D2 | P62837 | VPS18 | Q9P253 | Yes | Yes | No | SIGNOR | SIGNOR:16203730 |
Page 2 of 2Previous
Protein Complex Composition (27)
27 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CBLUBE2D2ZAP70 | P22681P43403P62837 | 1:1:1 | PDB | PDB:4a4cPDB:4a4b | ||
| CBLUBE2D2 | P22681P62837 | 1:1 | PDB | PDB:4a49 | ||
| UBE2D2 | P62837 | 4 | PDB | PDB:8vk8PDB:2clwPDB:8jwuPDB:8vk9 | ||
| BTRCCUL1RBX1SKP1UBE2D2 | P62837P62877P63208Q13616Q9Y297 | 0:0:0:0:0 | KEGG-MEDICUS | |||
| MDM2RPS27AUBE2D2 | P62837P62979Q00987 | 2:2:2 | PDB | PDB:6sqo | ||
| MUL1UBE2D2 | P62837Q969V5 | 4:4 | PDB | PDB:6m2c | ||
| RLIMUBE2D2 | P62837Q9NVW2 | 1:1 | PDB | PDB:6w7z |
Page 3 of 3Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30915084 |
Sequence, Structure & Domains12
Sequences
Length
147
Mass
16,735
Sequence
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P62837-1; Sequence=Displayed; Name=2; IsoId=P62837-2; Sequence=VSP_045180
Alternative Sequence
1..29; Missing (in isoform 2)
3D Structural Models
Turn
44..47; 58..61; 90..92
Helix
1..15; 87..89; 99..111; 121..129; 131..145
Beta Strand
19..28; 32..38; 41..43; 49..55; 66..71; 76..78; 82..84; 115..117
3D Structure
Electron microscopy (4); NMR spectroscopy (2); X-ray crystallography (52)
Domain & Motif Annotations
Domain (FT)
1..147; UBC core
Protein Families
Ubiquitin-conjugating enzyme family
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.
Clinical Relevance4
Antibody
Interaction Protein (33)
ENSG00000022840ENSG00000023445ENSG00000070423ENSG00000072609ENSG00000091073ENSG00000092098ENSG00000101871ENSG00000101966ENSG00000103266ENSG00000103429ENSG00000108375ENSG00000110395ENSG00000121481ENSG00000123091ENSG00000124226ENSG00000138100ENSG00000138942ENSG00000146755ENSG00000157450ENSG00000159461ENSG00000163481ENSG00000165886ENSG00000167770ENSG00000168411ENSG00000173456ENSG00000175104ENSG00000186187ENSG00000196470ENSG00000198625ENSG00000198919ENSG00000204227ENSG00000204308ENSG00000265491
Interaction Count
33
Interaction Dataset (2)
intact_biogridintact_biogrid_bioplex
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28396511 | Database-augmented Mass Spectrometry Analysis of Exosomes Identifies Claudin 3 as a Putative Prostate Cancer Biomarker. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No abstract available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |
| 34623918 | Metabolic responsiveness to training depends on insulin sensitivity and protein content of exosomes in insulin-resistant males. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No abstract available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |