Protein detail
GBB2
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 (G protein subunit beta-2) (Transducin beta chain 2)
Protein symbol GBB2 | UniProt ID | EVMP score 0.63 |
Frequency 10 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteinsTransporters |
Basic Information
Protein Names
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 (G protein subunit beta-2) (Transducin beta chain 2)
Protein Class
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Ensembl
Entrez Gene Symbol
Gene Description
G protein subunit beta 2
Chromosome
7
Position
100673567-100679174
Frequency
10
EVMP Score
0.63
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAdipocytesSingle-Nuclei Brain Specifichippocampal CA4
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Cellular Component
- GO:0005615 extracellular space
- GO:0005737 cytoplasm
- GO:0005765 lysosomal membrane
- GO:0005829 cytosol
- GO:0005834 heterotrimeric G-protein complex
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0016020 membrane
- GO:0031982 vesicle
- GO:0048471 perinuclear region of cytoplasm
- GO:0070062 extracellular exosome
Molecular Function
Biological Process
KEGG
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
- KEGG:hsa04726 Serotonergic synapse
- KEGG:hsa04727 GABAergic synapse
- KEGG:hsa04728 Dopaminergic synapse
- KEGG:hsa04926 Relaxin signaling pathway
- KEGG:hsa05032 Morphine addiction
- KEGG:hsa05034 Alcoholism
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05200 Pathways in cancer
Reactome
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-373080 class b 2 secretin family receptors
- R-hsa-6814122 cooperation of pdcl phlp1 and tric cct in g protein beta folding
- R-hsa-8939211 esr mediated signaling
- R-hsa-9009391 extra nuclear estrogen signaling
- R-hsa-977444 gaba b receptor activation
- R-hsa-977443 gaba receptor activation
- R-hsa-381676 glucagon like peptide 1 glp1 regulates insulin secretion
- R-hsa-163359 glucagon signaling in metabolic regulation
- R-hsa-420092 glucagon type ligand receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-9634597 gper1 signaling
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-418594 g alpha i signalling events
- R-hsa-416476 g alpha q signalling events
- R-hsa-418555 g alpha s signalling events
- R-hsa-418597 g alpha z signalling events
- R-hsa-8964616 g beta gamma signalling through cdc42
- R-hsa-392451 g beta gamma signalling through pi3kgamma
- R-hsa-202040 g protein activation
- R-hsa-397795 g protein beta gamma signalling
- R-hsa-109582 hemostasis
- R-hsa-9856530 high laminar flow shear stress activates signaling by piezo1 and pecam1 cdh5 kdr in endothelial cells
- R-hsa-5663205 infectious disease
- R-hsa-163685 integration of energy metabolism
- R-hsa-1296065 inwardly rectifying k channels
- R-hsa-9658195 leishmania infection
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-111885 opioid signalling
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-418346 platelet homeostasis
- R-hsa-1296071 potassium channels
- R-hsa-500657 presynaptic function of kainate receptors
- R-hsa-392851 prostacyclin signalling through prostacyclin receptor
- R-hsa-391251 protein folding
- R-hsa-422356 regulation of insulin secretion
- R-hsa-372790 signaling by gpcr
- R-hsa-9006931 signaling by nuclear receptors
- R-hsa-195721 signaling by wnt
- R-hsa-392518 signal amplification
- R-hsa-456926 thrombin signalling through proteinase activated receptors pars
- R-hsa-428930 thromboxane signalling through tp receptor
- R-hsa-112315 transmission across chemical synapses
- R-hsa-382551 transport of small molecules
- R-hsa-432040 vasopressin regulates renal water homeostasis via aquaporins
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| extracellular | extracellular | OmniPath | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SMO | Q99835 | GBB2 | P62879 | Yes | Yes | No | SIGNOR | SIGNOR:16885213SIGNOR:23074268 |
Protein Complex Composition
9 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GNAI1-GNB2-GNG12 complex | GNAI1GNB2GNG12 | P62879P63096Q9UBI6 | 0:0:0 | CORUM | CORUM:7087 | 25733868 |
| GNAI1-GNB2-GNG13 complex | GNAI1GNB2GNG13 | P62879P63096Q9P2W3 | 0:0:0 | CORUM | CORUM:7093 | 25733868 |
| GNAI1-GNB2-GNG4 complex | GNAI1GNB2GNG4 | P50150P62879P63096 | 0:0:0 | CORUM | CORUM:7032 | 25733868 |
| GNAI1-GNB2-GNG8 complex | GNAI1GNB2GNG8 | P62879P63096Q9UK08 | 0:0:0 | CORUM | CORUM:7072 | 25733868 |
| GNAI1-GNB2-GNGT1 complex | GNAI1GNB2GNGT1 | P62879P63096P63211 | 0:0:0 | CORUM | CORUM:7015 | 25733868 |
| GNB2GNB5PDCLRGS6RGS9 | O14775O75916P49758P62879Q13371 | 0:0:0:0:0 | hu.MAP2 | |||
| GNB2GNB5PDCLRGS6 | O14775P49758P62879Q13371 | 0:0:0:0 | hu.MAP2 | |||
| CCT7GNB2GNB5KLHDC8BPDCL | O14775P62879Q13371Q8IXV7Q99832 | 0:0:0:0:0 | hu.MAP2 | |||
| ANXA7GNB2PDHBUBC | P0CG48P11177P20073P62879 | 1:1:1:1 | CompleatCFinder | Compleat:HC7830 |
Sequence, Structure & Domains
Sequences
Length
340
Mass
37,331
Sequence
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P62879-1; Sequence=Displayed; Name=2; IsoId=P62879-2; Sequence=VSP_056515
Alternative Sequence
1..100; Missing (in isoform 2)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Repeat
53..83; WD 1; 95..125; WD 2; 141..170; WD 3; 182..212; WD 4; 224..254; WD 5; 268..298; WD 6; 310..340; WD 7
Protein Families
WD repeat G protein beta family
Sequence Similarities
Belongs to the WD repeat G protein beta family.
Clinical Relevance
Disease Involvement
Disease variantIntellectual disability
Interaction Protein
ENSG00000001626ENSG00000065135ENSG00000082701ENSG00000087191ENSG00000088356ENSG00000101132ENSG00000113068ENSG00000115484ENSG00000115539ENSG00000120438ENSG00000123349ENSG00000135624ENSG00000136940ENSG00000143256ENSG00000146731ENSG00000150753ENSG00000155959ENSG00000156261ENSG00000163468ENSG00000166226ENSG00000174021ENSG00000186469ENSG00000204220ENSG00000242616
Interaction Count
24
Interaction Dataset
intact_biogridbiogrid_bioplex