Protein detail
GBB2
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 (G protein subunit beta-2) (Transducin beta chain 2)
Entry name GBB2 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 10 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 (G protein subunit beta-2) (Transducin beta chain 2)
Protein Class (6)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteinsTransporters
Protein Function (7)
- Predicted intracellular proteins
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Ensembl
Entrez Gene Symbol
Gene Description
G protein subunit beta 2
Chromosome
7
Position
100673567-100679174
Supporting publications (n)
10
EVMP confidence score
0.63
Fluorescence & Localization3
Tissue SpecificbrainCell SpecificAdipocytesSingle-Nuclei Brain Specifichippocampal CA4
Function & Pathway7
Protein Function (7)
- Predicted intracellular proteins
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Cellular Component (11)
- GO:0005615 extracellular space
- GO:0005737 cytoplasm
- GO:0005765 lysosomal membrane
- GO:0005829 cytosol
- GO:0005834 heterotrimeric G-protein complex
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0016020 membrane
- GO:0031982 vesicle
- GO:0048471 perinuclear region of cytoplasm
Page 1 of 2
Molecular Function (5)
Biological Process (3)
KEGG (20)
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
Page 1 of 2
Reactome (56)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
Page 1 of 6
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence20
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| extracellular | extracellular | OmniPath | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SMO | Q99835 | GBB2 | P62879 | Yes | Yes | No | SIGNOR | SIGNOR:16885213SIGNOR:23074268 |
Protein Complex Composition (9)
9 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GNAI1-GNB2-GNG12 complex | GNAI1GNB2GNG12 | P62879P63096Q9UBI6 | 0:0:0 | CORUM | CORUM:7087 | 25733868 |
| GNAI1-GNB2-GNG13 complex | GNAI1GNB2GNG13 | P62879P63096Q9P2W3 | 0:0:0 | CORUM | CORUM:7093 | 25733868 |
| GNAI1-GNB2-GNG4 complex | GNAI1GNB2GNG4 | P50150P62879P63096 | 0:0:0 | CORUM | CORUM:7032 | 25733868 |
| GNAI1-GNB2-GNG8 complex | GNAI1GNB2GNG8 | P62879P63096Q9UK08 | 0:0:0 | CORUM | CORUM:7072 | 25733868 |
| GNAI1-GNB2-GNGT1 complex | GNAI1GNB2GNGT1 | P62879P63096P63211 | 0:0:0 | CORUM | CORUM:7015 | 25733868 |
| GNB2GNB5PDCLRGS6RGS9 | O14775O75916P49758P62879Q13371 | 0:0:0:0:0 | hu.MAP2 | |||
| GNB2GNB5PDCLRGS6 | O14775P49758P62879Q13371 | 0:0:0:0 | hu.MAP2 | |||
| CCT7GNB2GNB5KLHDC8BPDCL | O14775P62879Q13371Q8IXV7Q99832 | 0:0:0:0:0 | hu.MAP2 | |||
| ANXA7GNB2PDHBUBC | P0CG48P11177P20073P62879 | 1:1:1:1 | CompleatCFinder | Compleat:HC7830 |
Sequence, Structure & Domains9
Sequences
Length
340
Mass
37,331
Sequence
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P62879-1; Sequence=Displayed; Name=2; IsoId=P62879-2; Sequence=VSP_056515
Alternative Sequence
1..100; Missing (in isoform 2)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Repeat
53..83; WD 1; 95..125; WD 2; 141..170; WD 3; 182..212; WD 4; 224..254; WD 5; 268..298; WD 6; 310..340; WD 7
Protein Families
WD repeat G protein beta family
Sequence Similarities
Belongs to the WD repeat G protein beta family.
Clinical Relevance5
Disease Involvement (2)
Disease variantIntellectual disability
Interaction Protein (24)
ENSG00000001626ENSG00000065135ENSG00000082701ENSG00000087191ENSG00000088356ENSG00000101132ENSG00000113068ENSG00000115484ENSG00000115539ENSG00000120438ENSG00000123349ENSG00000135624ENSG00000136940ENSG00000143256ENSG00000146731ENSG00000150753ENSG00000155959ENSG00000156261ENSG00000163468ENSG00000166226ENSG00000174021ENSG00000186469ENSG00000204220ENSG00000242616
Interaction Count
24
Interaction Dataset (2)
intact_biogridbiogrid_bioplex
Supporting Publications10
| PMID | Title | Abstract |
|---|---|---|
| 30301952 | A position on vision. | No abstract available |
| 32002171 | Activated human astrocyte-derived extracellular vesicles modulate neuronal uptake, differentiation and firing. | No abstract available |
| 32679759 | Selectively-Packaged Proteins in Breast Cancer Extracellular Vesicles Involved in Metastasis. | No abstract available |
| 37886648 | Pathological mechanisms of type 1 diabetes in children: investigation of the exosomal protein expression profile. | No abstract available |
| 38343172 | Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles. | No abstract available |
| 39025337 | Shotgun proteomics of thyroid carcinoma exosomes - Insight into the role of exosomal proteins in carcinogenesis and thyroid homeostasis. | No abstract available |
| 39277144 | The proteomic signature of circulating extracellular vesicles following intracerebral hemorrhage: Novel insights into mechanisms underlying recovery. | No abstract available |
| 39363010 | Proteomic analysis of plasma-derived extracellular vesicles: pre- and postprandial comparisons. | No abstract available |
| 40222457 | Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement. | No abstract available |
| 40595564 | Enrichment of extracellular vesicles using Mag-Net for the analysis of the plasma proteome. | No abstract available |