Protein detail
GBG3
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
Entry name GBG3 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 0 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
0
EVMP confidence score
0.47
Fluorescence & Localization
Tissue SpecifictestisCell SpecificEarly spermatids
Function & Pathway
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
KEGG (20)
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
Page 1 of 2
Reactome (56)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
Page 1 of 6
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence11
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SMO | Q99835 | GBG3 | P63215 | Yes | Yes | SIGNOR | SIGNOR:16885213SIGNOR:23074268 | |
| GBG3 | P63215 | COMPLEX:P27986_P42336 | Yes | Yes | SIGNOR | SIGNOR:16537363SIGNOR:17419683 | ||
| GBG3 | P63215 | PK3CA | P42336 | Yes | Yes | WangSIGNOR | SIGNOR:16537363SIGNOR:17419683 | |
| GBG3 | P63215 | PLCG1 | P19174 | Yes | Yes | SIGNOR | SIGNOR:23074268 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
75
Mass
8,305
Sequence
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Domain & Motif Annotations
Protein Families
G protein gamma family
Sequence Similarities
Belongs to the G protein gamma family.