Protein detail
CXAR
Coxsackievirus and adenovirus receptor (CAR) (hCAR) (CVB3-binding protein) (Coxsackievirus B-adenovirus receptor) (HCVADR)
Entry name CXAR | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification Predicted membrane proteinsPredicted secreted proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Coxsackievirus and adenovirus receptor (CAR) (hCAR) (CVB3-binding protein) (Coxsackievirus B-adenovirus receptor) (HCVADR)
Protein Class (3)
Predicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (2)
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
Transmembrane
238..258; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CAR
Gene Description
CXADR Ig-like cell adhesion molecule
Chromosome
21
Position
17513043-17593579
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificendometrium 1Cell SpecificBrain inhibitory neuronsSingle-Nuclei Brain Specificeccentric medium spiny neuron
Function & Pathway
Protein Function (2)
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
Cellular Component (20)
- GO:0001669 acrosomal vesicle
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005654 nucleoplasm
- GO:0005737 cytoplasm
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005912 adherens junction
- GO:0005923 bicellular tight junction
- GO:0014704 intercalated disc
Page 1 of 2
Molecular Function (10)
- GO:0001618 virus receptor activity
- GO:0005102 signaling receptor binding
- GO:0005178 integrin binding
- GO:0005515 protein binding
- GO:0008013 beta-catenin binding
- GO:0030165 PDZ domain binding
- GO:0042802 identical protein binding
- GO:0050839 cell adhesion molecule binding
- GO:0071253 connexin binding
- GO:0086082 cell adhesive protein binding involved in AV node cell-bundle of His cell communication
Biological Process (3)
KEGG (4)
Reactome (4)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence66
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CXADR | CDK1 | P06493 | S | 332 | phosphorylation | KEA | KEA:17570479 |
| CXADR | GSK3B | P49841 | S | 332 | phosphorylation | KEA | KEA:17570479 |
| CXADR | MAPK9 | P45984 | S | 332 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (57)
57 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | Yes | Yes | |
| tight_junction | tight_junction | Ramilowski_location | Yes | Yes | Yes | Yes | |
| tight_junction | tight_junction | OmniPath | Yes | Yes | Yes | Yes | |
| adherens_junction | adherens_junction | Ramilowski_location | Yes | Yes | Yes | ||
| adherens_junction | adherens_junction | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_topology | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_keyword | Yes | Yes |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Car-Jam3 complex | CXADRJAM3 | P78310Q9BX67 | 1:1 | Compleat | Compleat:HC635 | 16410001 |
| Car-Lnx2 complex | CXADRLNX2 | P78310Q8N448 | 1:1 | Compleat | Compleat:HC3093 | 15979067 |
| AGFG1CXADRGRHPRIDH3ASUCLA2 | P50213P52594P78310Q9P2R7Q9UBQ7 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_414 | ||
| CXADR | P78310 | 2 | PDB | PDB:1eajPDB:1f5w | ||
| ACOT1CXADRHIBCHIRF2BPL | P78310Q6NVY1Q86TX2Q9H1B7 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_185 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
365
Mass
40,030
Sequence
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIV
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=SIV; IsoId=P78310-1; Sequence=Displayed; Name=2; Synonyms=CAR2, HCAR2, TVV; IsoId=P78310-2; Sequence=VSP_014825, VSP_014826; Name=3; Synonyms=CAR2/7, Gamma; IsoId=P78310-3; Sequence=VSP_014819, VSP_014820; Name=4; Synonyms=CAR3/7; IsoId=P78310-4; Sequence=VSP_014821, VSP_014822; Name=5; Synonyms=CAR4/7, Beta; IsoId=P78310-5; Sequence=VSP_014823, VSP_014824; Name=6; IsoId=P78310-6; Sequence=VSP_047357; Name=7; Synonyms=CAR 4/6; IsoId=P78310-7; Sequence=VSP_047729
Alternative Sequence
71..89; IILYSGDKIYDDYYPDLKG -> GRCATSKEPYVHCQKLHRQ (in isoform 3); 90..365; Missing (in isoform 3); 139; V -> GKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSITKYQVKTLNALLRVRLSHLLR (in isoform 4); 140..365; Missing (in isoform 4); 191..232; EMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPP -> A (in isoform 7); 191; E -> GKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSITKYQVKTLNALLRVRLSHLLR (in isoform 5); 192..365; Missing (in isoform 5); 340..365; VAAPNLSRMGAIPVMIPAQSKDGSIV -> FKYPYKTDGITVV (in isoform 6); 340..345; VAAPNL -> FKYPY (in isoform 2); 346..365; Missing (in isoform 2)
3D Structural Models
Turn
86..90
Helix
98..100; 112..114; 185..192
Beta Strand
21..32; 37..39; 42..44; 53..61; 62..65; 68..75; 78..80; 91..93; 105..107; 116..124; 127..138; 145..148; 156..163; 166..168; 171..178; 195..201; 208..215; 221..227
3D Structure
Electron microscopy (12); NMR spectroscopy (2); X-ray crystallography (9)
Domain & Motif Annotations
Compositional Bias
269..282; Basic and acidic residues; 286..322; Polar residues
Motif
360..365; PDZ-binding
Domain (CC)
The Ig-like C2-type 1 domain mediates homodimerization and interaction with JAML.; DOMAIN: The PDZ-binding motif mediates interaction with MPDZ and MAGI1.
Domain (FT)
20..134; Ig-like C2-type 1; 141..228; Ig-like C2-type 2
Region
269..343; Disordered
Clinical Relevance
Drugs (7)
Interaction Protein
ENSG00000127022
Interaction Count
1
Interaction Dataset
biogrid_opencell
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |