Protein detail
DLG4
Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)
Entry name DLG4 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)
Protein Class (5)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsTransporters
Protein Function (5)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
PSD-95PSD95SAP-90SAP90
Gene Description
Discs large MAGUK scaffold protein 4
Chromosome
17
Position
7187187-7219841
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue SpecificplacentaCell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway8
Protein Function (5)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component (27)
- GO:0005737 cytoplasm
- GO:0005783 endoplasmic reticulum
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005912 adherens junction
- GO:0008021 synaptic vesicle
- GO:0008076 voltage-gated potassium channel complex
- GO:0014069 postsynaptic density
- GO:0016323 basolateral plasma membrane
- GO:0030054 cell junction
Page 1 of 3
Molecular Function (13)
- GO:0005515 protein binding
- GO:0019900 kinase binding
- GO:0019901 protein kinase binding
- GO:0019903 protein phosphatase binding
- GO:0030165 PDZ domain binding
- GO:0031697 beta-1 adrenergic receptor binding
- GO:0031748 D1 dopamine receptor binding
- GO:0031812 P2Y1 nucleotide receptor binding
- GO:0033130 acetylcholine receptor binding
- GO:0035255 ionotropic glutamate receptor binding
Page 1 of 2
Biological Process (3)
KEGG (5)
Reactome (27)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-442755 activation of nmda receptors and postsynaptic events
- R-hsa-9609736 assembly and cell surface presentation of nmda receptors
- R-hsa-442742 creb1 phosphorylation through nmda receptor mediated activation of ras signaling
- R-hsa-451306 ionotropic activity of kainate receptors
- R-hsa-373760 l1cam interactions
- R-hsa-5682910 lgi adam interactions
- R-hsa-9620244 long term potentiation
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
Page 1 of 3
Canonical Pathways
M8626 Sig bcr signaling pathway
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence73
Enzyme-Mediated Modification (20)
20 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DLG4 | FYN | P06241 | Y | 523 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:25720756SIGNOR:18721130ProtMapper:18721130 |
| DLG4 | FYN | P06241 | Y | 566 | phosphorylation | MIMPPhosphoSite_MIMP | |
| DLG4 | SRC | P12931 | Y | 523 | phosphorylation | SIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:24981431SIGNOR:24981431 |
| DLG4 | SRC | P12931 | Y | 566 | phosphorylation | MIMPPhosphoSite_MIMP | |
| DLG4 | CAMK2A | Q9UQM7 | S | 73 | phosphorylation | PhosphoSite | |
| DLG4 | MARK2 | Q7KZI7 | S | 561 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| DLG4 | YRDC | Q86U90 | Y | 523 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:22709448 |
| DLG4 | F2R | P25116 | S | 561 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:26839714ProtMapper:17690075 |
| DLG4 | MARK1 | Q9P0L2 | S | 561 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:26839714 |
| DLG4 | MAPK1 | P28482 | S | 290 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:26567109ProtMapper:14741046 |
Page 1 of 2Next
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (42)
42 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MARK2 | Q7KZI7 | DLG4 | P78352 | Yes | No | No | iPTMnetPhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:22807451 |
| KCC2A | Q9UQM7 | DLG4 | P78352 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:28692247PhosphoSite:25393018 |
Page 5 of 5Previous
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| DLGAP1-DLG4-DYNLL2 complex | DLG4DLGAP1DYNLL2 | O14490P78352Q96FJ2 | 0:0:0 | CORUM | CORUM:7234 | 10844022 |
| DLG4KCNJ2 | P63252P78352 | 2:1 | PDB | PDB:6spz | ||
| DLG4 | P78352 | 4 | PDB | PDB:3zrtPDB:6qjfPDB:6qjnPDB:6qjiPDB:6qjlPDB:6qjgPDB:8ah6PDB:6qjdPDB:8ah4PDB:3i4w | ||
| DLG4UFC1 | P78352Q9Y3C8 | 0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains14
Sequences
Length
724
Mass
80,495
Sequence
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=PSD95-alpha; IsoId=P78352-1; Sequence=Displayed; Name=2; Synonyms=PSD95-beta; IsoId=P78352-2; Sequence=VSP_014929; Name=3; IsoId=P78352-3; Sequence=VSP_047247
Alternative Sequence
1..10; MDCLCIVTTK -> MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQ (in isoform 2); 51..53; Missing (in isoform 3)
3D Structural Models
Turn
302..305
Helix
2..15; 104..108; 130..138; 199..203; 225..233; 346..350; 372..380; 394..400
Beta Strand
61..69; 72..74; 76..85; 87..90; 94..99; 116..120; 126..128; 142..151; 157..164; 171..176; 178..180; 189..194; 211..215; 237..245; 308..310; 312..317; 324..331; 334..341; 343..345; 357..362; 384..392
3D Structure
NMR spectroscopy (3); X-ray crystallography (19)
Domain & Motif Annotations
Domain (CC)
The PDZ domain 3 mediates interaction with ADR1B.; DOMAIN: The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density.
Domain (FT)
65..151; PDZ 1; 160..246; PDZ 2; 313..393; PDZ 3; 428..498; SH3; 534..709; Guanylate kinase-like
Region
15..35; Disordered
Protein Families
MAGUK family
Sequence Similarities
Belongs to the MAGUK family.
Clinical Relevance8
Disease Involvement (2)
Disease variantIntellectual disability
Related Diseases (2)
Biomarker
Phase 3
Interaction Protein (11)
ENSG00000111262ENSG00000119878ENSG00000135679ENSG00000161509ENSG00000170579ENSG00000178568ENSG00000182255ENSG00000183454ENSG00000197283ENSG00000197555ENSG00000273079
Interaction Count
11
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No abstract available |