Protein detail
DRB3
HLA class II histocompatibility antigen, DR beta 3 chain (MHC class II antigen DRB3)
Entry name DRB3 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
HLA class II histocompatibility antigen, DR beta 3 chain (MHC class II antigen DRB3)
Transmembrane
228..248; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
4
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificovaryCell SpecificAstrocytes
Function & Pathway
Cellular Component (13)
- GO:0000139 Golgi membrane
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030658 transport vesicle membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031902 late endosome membrane
- GO:0032588 trans-Golgi network membrane
Page 1 of 2
Molecular Function (4)
Biological Process (3)
KEGG (24)
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
Page 1 of 3
Reactome (11)
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
Page 1 of 2
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence36
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| HLA-DRB3 | MARCHF8 | Q5T0T0 | K | 254 | polyubiquitination | SIGNOR | SIGNOR:19117940 |
| HLA-DRB3 | MARCHF1 | Q8TCQ1 | K | 254 | polyubiquitination | SIGNOR | SIGNOR:19117940 |
Ligand-Receptor Signaling (27)
27 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| ligand | ligand | ICELLNET | Yes | Yes | |||
| checkpoint | ligand | ICELLNET | Yes | Yes | |||
| checkpoint_lag3 | ligand | ICELLNET | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 3 of 3Previous
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MARH8 | Q5T0T0 | DRB3 | P79483 | Yes | Yes | SIGNOR | SIGNOR:19117940 | |
| MARH1 | Q8TCQ1 | DRB3 | P79483 | Yes | Yes | SIGNOR | SIGNOR:19117940 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class II MHC | HLA-DOAHLA-DRB3 | P06340P79483 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMAHLA-DRB3 | P28067P79483 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOAHLA-DRB3 | CHEBI:166824CHEBI:53000P06340P79483 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMAHLA-DRB3 | CHEBI:166824CHEBI:53000P28067P79483 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
266
Mass
29,962
Sequence
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
3D Structural Models
Turn
48..51; 71..73; 94..96; 116..121
Helix
81..83; 84..91; 100..102; 103..106; 108..115
Beta Strand
36..47; 52..61; 64..70; 75..80; 127..134; 142..154; 157..162; 165..167; 171..173; 180..182; 184..192; 200..205; 213..217
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Domain (CC)
The beta-1 domain is a structural part of the peptide-binding cleft. It contains one alpha helix and 4 beta sheets, respectively forming part of the wall and the floor of the peptide-binding cleft. The other 4 beta sheets of the floor and the second alpha helix wall is formed by the alpha-1 domain of HLA-DRA. Forms hydrogen bonds with the peptide main chain via conserved amino acid in most HLA-DRB molecules. The polymorphic residues accomodate the side chains of the peptide conferring peptide specificity to distinct HLA-DRB3 alleles (PubMed:17583734, PubMed:18697946). The peptide-bound beta-1 domain forms hydrogen bonds with CDR2 and CDR3 alpha-domains of TCR (By similarity).; DOMAIN: The beta-2 Ig-like domain mediates the interaction with CD4 coreceptor.
Domain (FT)
126..214; Ig-like C1-type
Region
30..124; Beta-1; 125..227; Beta-2
Protein Families
MHC class II family
Sequence Similarities
Belongs to the MHC class II family.
Clinical Relevance
Drugs (4)
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 31382537 | An Insight into the Proteome of Uveal Melanoma-Derived Ectosomes Reveals the Presence of Potentially Useful Biomarkers. | No related sentences available |
| 35119778 | Optimization of small extracellular vesicle isolation from expressed prostatic secretions in urine for in-depth proteomic analysis. | No related sentences available |
| 36394150 | A large-scale targeted proteomics of plasma extracellular vesicles shows utility for prognosis prediction subtyping in colorectal cancer. | No related sentences available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No related sentences available |