Protein detail
BASP1
Brain acid soluble protein 1 (22 kDa neuronal tissue-enriched acidic protein) (Neuronal axonal membrane protein NAP-22)
Entry name BASP1 | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 34 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Brain acid soluble protein 1 (22 kDa neuronal tissue-enriched acidic protein) (Neuronal axonal membrane protein NAP-22)
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsTransporters
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CAP-23CAP23NAP-22NAP22
Gene Description
Brain abundant membrane attached signal protein 1
Chromosome
5
Position
17065598-17276843
Supporting publications (n)
34
EVMP confidence score
0.75
Fluorescence & Localization
Tissue SpecificliverCell SpecificCardiomyocytes
Function & Pathway
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Cellular Component (13)
- GO:0000785 chromatin
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0008180 COP9 signalosome
- GO:0016363 nuclear matrix
- GO:0016605 PML body
- GO:0016607 nuclear speck
- GO:0030054 cell junction
Page 1 of 2
Molecular Function (5)
Biological Process (3)
Reactome (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence9
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster29 | ABHD16AABHD16BBASP1CETN2H3-3APEX14PEX5PEX5LRPS15AWWTR1YAP1 | O75381O95870P41208P46937P50542P62244P80723P84243Q8IYB4Q9GZV5Q9H3Z7 | 1:1:1:1:1:1:1:2:1:1:1 | Compleat | Compleat:HC2107 | 22036573 |
| ATP5F1AATP5F1BATP5F1DBASP1EIF2APA2G4SERBP1 | P06576P25705P30049P80723Q8NC51Q9BY44Q9UQ80 | 0:0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_536 | ||
| BASP1DHX29SERBP1 | P80723Q7Z478Q8NC51 | 0:0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Ultracentrifugation | Flow cytometry | 1 | 37862381 |
Sequence, Structure & Domains
Sequences
Length
227
Mass
22,693
Sequence
MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P80723-1; Sequence=Displayed; Name=2; IsoId=P80723-2; Sequence=VSP_037994
Alternative Sequence
88..141; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
1..11; Basic residues; 15..27; Basic and acidic residues; 49..105; Basic and acidic residues; 106..139; Low complexity; 140..152; Basic and acidic residues; 173..185; Polar residues; 218..227; Polar residues
Region
1..227; Disordered
Protein Families
BASP1 family
Sequence Similarities
Belongs to the BASP1 family.
Supporting Publications34
| PMID | Title | Related sentences |
|---|---|---|
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40840701 | Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |
Page 4 of 4Previous