Protein detail
EFNB1
Ephrin-B1 (EFL-3) (ELK ligand) (ELK-L) (EPH-related receptor tyrosine kinase ligand 2) (LERK-2) [Cleaved into: Ephrin-B1 C-terminal fragment (Ephrin-B1 CTF); Ephrin-B1 intracellular domain (Ephrin-B1 ICD)]
Entry name EFNB1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Ephrin-B1 (EFL-3) (ELK ligand) (ELK-L) (EPH-related receptor tyrosine kinase ligand 2) (LERK-2) [Cleaved into: Ephrin-B1 C-terminal fragment (Ephrin-B1 CTF); Ephrin-B1 intracellular domain (Ephrin-B1 ICD)]
Protein Class (5)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins
Protein Function (3)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Other congenital malformations
Transmembrane
238..258; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CFNSElk-LEPLG2LERK2
Gene Description
Ephrin B1
Chromosome
X
Position
68829021-68842160
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization3
Cell SpecificColonocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway7
Protein Function (3)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component (9)
Molecular Function (2)
Biological Process (3)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence63
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| EFNB1 | SRC | P12931 | Y | 317 | phosphorylation | Li2012 | |
| EFNB1 | EGF | P01133 | Y | 317 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:23811940 |
| EFNB1 | EPHB2 | P29323 | Y | 317 | phosphorylation | KEA | KEA:11466320KEA:11983165 |
Ligand-Receptor Signaling (54)
54 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellChatDB | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | No | Yes | No |
| ephrin | cell_surface_ligand | HGNC | Yes | No | No | Yes | No |
Page 1 of 6Next
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EFNB1 | P98172 | EPHB1 | P54762 | Yes | Yes | No | iTALKICELLNETSIGNORCellPhoneDB_CellinkerSignaLink3HPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrHPRDRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | Cellinker:9330863Baccin2019:10669731HPRD:12223469Cellinker:12223469Cellinker:15114347Baccin2019:12223469Baccin2019:9330863Baccin2019:11713248Cellinker:11713248connectomeDB2020:11713248connectomeDB2020:12223469SIGNOR:11713248HPMR:11713248HPRD:10669731connectomeDB2020:10669731LRdb:11114742CellChatDB:15114347Cellinker:10669731SignaLink3:23331499connectomeDB2020:9330863ICELLNET:24003208ICELLNET:15114347SignaLink3:9267020 |
| EFNB1 | P98172 | EPHB2 | P29323 | Yes | Yes | No | iTALKICELLNETCellPhoneDB_CellinkerSignaLink3HPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrHPRDRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | HPMR:9330863HPRD:8878483ICELLNET:24003208Cellinker:15114347LRdb:11114742Baccin2019:93308638878483CellChatDB:15114347ICELLNET:15114347SignaLink3:9576626SignaLink3:23331499connectomeDB2020:8878483connectomeDB2020:9330863 |
| EFNB1 | P98172 | EPHB3 | P54753 | Yes | Yes | No | iTALKICELLNETSIGNORCellPhoneDB_CellinkerSignaLink3HPMR_talklrHPMRCellChatDBDLRP_CellinkertalklrRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbCellPhoneDBBaccin2019CellinkerSTRING_talklrEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | Cellinker:9330863connectomeDB2020:9330863HPMR:9330863ICELLNET:24003208SIGNOR:9330863Cellinker:15114347LRdb:11114742CellChatDB:15114347ICELLNET:15114347SignaLink3:9576626SignaLink3:23331499Baccin2019:9330863 |
| PTN13 | Q12923 | EFNB1 | P98172 | Yes | Yes | No | HPRDWangSIGNORPDZBase | HPRD:9920925SIGNOR:23811940PDZBase:9920925 |
| EFNB1 | P98172 | EPHB4 | P54760 | Yes | Yes | No | iTALKICELLNETSIGNORCellPhoneDB_CellinkerHPMR_talklrCellChatDBDLRP_CellinkertalklrRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbCellPhoneDBBaccin2019CellinkerEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | connectomeDB2020:9330863ICELLNET:24003208SIGNOR:9330863Cellinker:15114347LRdb:11114742ICELLNET:15114347CellChatDB:15114347Baccin2019:9330863 |
Sequence, Structure & Domains10
Sequences
Length
346
Mass
38,007
Sequence
MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
205..218; Basic and acidic residues
Motif
260..273; Nuclear localization signal; 344..346; PDZ-binding
Domain (FT)
30..164; Ephrin RBD
Region
169..228; Disordered; 263..294; Interaction with ZHX2
Protein Families
Ephrin family
Sequence Similarities
Belongs to the ephrin family.
Clinical Relevance3
Disease Involvement (3)
Cancer-related genesCraniosynostosisDisease variant
Drugs (2)
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 2780759 | The optimal processing of plasma samples for the determination of bicyclo-PGE in patients with malignant maxillofacial tumors. | No abstract available |