EV MemProt Atlas

Basic Information11

Protein Names

Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)

Protein Class (6)

Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteins

Protein Function (7)

Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
Enzymes
Kinases:CMGC Ser/Thr protein kinases
Disease related genes

Ensembl

ENSG00000164885

Entrez Gene Symbol

CDK5

Gene Synonym

PSSALRE

Gene Description

Cyclin dependent kinase 5

Chromosome

7

Position

151053815-151057897

Supporting publications (n)

1

EVMP confidence score

0.38

Fluorescence & Localization5

Tissue Specificbone marrowCell SpecificNeutrophilsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificbasophil

Function & Pathway8

Protein Function (7)

Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
Enzymes
Kinases:CMGC Ser/Thr protein kinases
Disease related genes

Cellular Component (21)

Page 1 of 3

Molecular Function (15)

Page 1 of 2

Biological Process (3)

KEGG (4)

Reactome (29)

Page 1 of 3

Canonical Pathways (3)

M3468 Naba ecm regulators
M5885 Naba matrisome associated
M5889 Naba matrisome

Mediation Categories (5)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence203

Enzyme-Mediated Modification (23)

23 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CDK5	ABL1	P00519	Y	15	phosphorylation	BEL-Large-Corpus_ProtMapperSparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPNCI-PID_ProtMapperHPRD_MIMPSIGNORProtMapperHPRDRLIMS-P_ProtMapperdbPTMKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapper	HPRD:19413330 ProtMapper:26944284 dbPTM:18691976 dbPTM:19534553 ProtMapper:28646794 KEA:9038181 HPRD:19901323 ProtMapper:15212693 dbPTM:19369195 ProtMapper:24600352 HPRD:16497976 KEA:12372285 SIGNOR:10896159 dbPTM:18083107 dbPTM:19413330 ProtMapper:24975575 ProtMapper:23348931 KEA:10896159 dbPTM:19690332 HPRD:20068231 HPRD:12372285 KEA:15689152 ProtMapper:18794154 ProtMapper:10896159 phosphoELM:14757045 KEA:14757045 ProtMapper:19700222 HPRD:18691976 ProtMapper:29063113
CDK5	FYN	P06241	Y	15	phosphorylation	Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapper	KEA:10896159 HPRD:19413330 KEA:14757045 ProtMapper:14757045 ProtMapper:12372285 SIGNOR:14757045 HPRD:20068231 HPRD:16497976 KEA:12372285 HPRD:18691976 HPRD:12372285 KEA:9038181 ProtMapper:24872417 ProtMapper:20506281 ProtMapper:29063113 HPRD:19901323
CDK5	CSNK1D	P48730	S	159	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	ProtMapper:10500146 SIGNOR:10500146 KEA:10500146
CDK5	PRKCD	Q05655	T	77	phosphorylation	PhosphoSiteSparser_ProtMapperProtMapper	ProtMapper:29511352
CDK5	CSNK1A1	P48729	S	159	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEAPhosphoSitePhosphoSite_ProtMapper	KEA:10500146
CDK5	CSNK1G2	P78368	S	159	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPKEA	KEA:10500146
CDK5	TTBK2	Q6IQ55	S	159	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
CDK5	TTBK1	Q5TCY1	S	159	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
CDK5	VRK1	Q99986	S	159	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
CDK5	VRK2	Q86Y07	S	159	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP

Page 1 of 3Next

Ligand-Receptor Signaling (11)

11 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	scConnect	No	Yes	No	No	No

Page 2 of 2Previous

Regulatory Interaction Network (127)

127 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CDK5	Q00535	SYNJ1	O43426	Yes	Yes	Yes	HPRDWangPhosphoPointSIGNOR	SIGNOR:14704270 HPRD:14704270
CDK5	Q00535	CDN1B	P46527	Yes	No	Yes	Sparser_ProtMapperiPTMnetPhosphoPointSIGNORProtMapperREACH_ProtMapperHPRDHINTRLIMS-P_ProtMapperIntActLit-BM-17	HINT:23543736 ProtMapper:25452716 Lit-BM-17:15890360 HINT:25852190 HINT:32707033 HINT:15890360 Lit-BM-17:23455922 Lit-BM-17:23602568 ProtMapper:25205104 ProtMapper:20810788 ProtMapper:26146988 ProtMapper:27283769 HPRD:15890360 Lit-BM-17:26186194 IntAct:15890360 ProtMapper:23294285 SIGNOR:26146988 Lit-BM-17:23543736 Lit-BM-17:25852190 HINT:33961781 ProtMapper:32086342 ProtMapper:20519948 HINT:34591612
CDK5	Q00535	CREB1	P16220	Yes	Yes	No	SIGNOR	SIGNOR:29742423
CDK5	Q00535	NFM	P07197	Yes	No	Yes	SIGNOR	SIGNOR:28634551
CDK5	Q00535	SIR2	Q8IXJ6	Yes	Yes	No	Sparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapper	ProtMapper:31105527 ProtMapper:18332217 ProtMapper:26407304 ProtMapper:29158185 ProtMapper:20680393 SIGNOR:35443760
CDK5	Q00535	AMPH	P49418	Yes	Yes	No	WangSparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSite_ProtMapper	HPRD:11113134 ProtMapper:19584925 ProtMapper:14623869 ProtMapper:11113134 KEA:11113134 SIGNOR:11113134
CDK5	Q00535	KKCC2	Q96RR4	Yes	No	Yes	SIGNOR_ProtMapperiPTMnetSIGNORProtMapper	SIGNOR:22778263 ProtMapper:22778263
CDK5	Q00535	NEST	P48681	Yes	No	No	Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDRLIMS-P_ProtMapperPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperHPRD-phos	HPRD-phos:12832492 HPRD-phos:11278541 KEA:11278541 ProtMapper:21346193 SIGNOR:12832492 ProtMapper:12832492 ProtMapper:24556839 KEA:12832492 ProtMapper:20068231 HPRD-phos:20068231 HPRD-phos:18669648 ProtMapper:18669648 HPRD:12832492 ProtMapper:11278541 HPRD:11278541 ProtMapper:33396266
CDK5	Q00535	TLN1	Q9Y490	Yes	Yes	No	Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:29511352 PhosphoSite:19363486 ProtMapper:29511352 SIGNOR:19363486 PhosphoSite:24793790 ProtMapper:33410333 ProtMapper:19363486 ProtMapper:24793790 ProtMapper:33396266
CDK5	Q00535	DYN1	Q05193	Yes	Yes	No	WangSparser_ProtMapperPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperHPRD-phosPhosphoSite_ProtMapper	KEA:15302935 ProtMapper:12855954 KEA:12855954 HPRD-phos:12855954 ProtMapper:33893293 HPRD-phos:18088087 ProtMapper:19651622 ProtMapper:21765832 ProtMapper:27725702 SIGNOR:12855954 HPRD:12855954 ProtMapper:18088087 HPRD-phos:19651622 ProtMapper:32589750

Page 7 of 13Previous Next

Protein Complex Composition (41)

41 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CDK5RAP3 DDRGK1 UFL1 UFM1	O94874 P61960 Q96HY6 Q96JB5	0:0:0:0	hu.MAP
ABHD6 CDK5RAP3 DDRGK1 UFL1	O94874 Q96HY6 Q96JB5 Q9BV23	0:0:0:0	hu.MAP
CDK5 GOT1 MAST1 PC PEX11B UBC	O96011 P0CG48 P11498 P17174 Q00535 Q9Y2H9	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3644
CABLES1 CCNC CCND2 CCNE1 CDK1 CDK2 CDK5 CDK6 CDKN1B CKMT1A CKS1B MRPL42	P06493 P12532 P24863 P24864 P24941 P30279 P46527 P61024 Q00534 Q00535 Q8TDN4 Q9Y6G3	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4322
CABLES1 CCNA1 CCNA2 CCNB1 CCND2 CCNE1 CDK1 CDK2 CDK5 CDK6 CDKN1B CKS1B SKP2 SRSF2	P06493 P14635 P20248 P24864 P24941 P30279 P46527 P61024 P78396 Q00534 Q00535 Q01130 Q13309 Q8TDN4	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7129
CABLES1 CCNC CCND2 CCNE1 CCNG1 CDK1 CDK2 CDK5 CDK6 CDKN1B CKS1B MRPL42 TCF7L2	P06493 P24863 P24864 P24941 P30279 P46527 P51959 P61024 Q00534 Q00535 Q8TDN4 Q9NQB0 Q9Y6G3	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3905
CDK5RAP1 DIS3 EXOSC1 EXOSC10 EXOSC2 EXOSC3 EXOSC4 EXOSC5 EXOSC6 LAMB1 MPHOSPH6 MTREX NUP210 PALS2 SUPT6H	P07942 P42285 Q01780 Q13868 Q5RKV6 Q7KZ85 Q8TEM1 Q96SZ6 Q99547 Q9NPD3 Q9NQT4 Q9NQT5 Q9NZW5 Q9Y2L1 Q9Y3B2	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7211
CDK5RAP2 DSP GLI3 GPSM2 PRKACA STK36	P10071 P15924 P17612 P81274 Q96SN8 Q9NRP7	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4869
CDK5RAP2 PRKACB RBM39 RPL27A	P22694 P46776 Q14498 Q96SN8	1:1:1:1	NetworkBlastCompleat	Compleat:HC8071
CDK5RAP3 GCSH	P23434 Q96JB5	0:0	hu.MAP

Page 3 of 5Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	27605433

Sequence, Structure & Domains12

Sequences

Length

292

Mass

33,304

Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q00535-1; Sequence=Displayed; Name=2; Synonyms=CDK5-SV; IsoId=Q00535-2; Sequence=VSP_041948

Alternative Sequence

105..136; Missing (in isoform 2)

3D Structural Models

Turn

24..26; 197..199; 224..226

Helix

46..55; 87..94; 100..119; 129..131; 145..147; 165..167; 170..173; 182..196; 208..219; 228..232; 248..250; 257..266; 271..273; 277..281; 284..286

Beta Strand

4..12; 14..23; 29..36; 40..42; 66..70; 76..81; 84..86; 132..134; 140..142; 287..289

3D Structure

X-ray crystallography (10)

Domain & Motif Annotations

Domain (FT)

4..286; Protein kinase

Protein Families (3)

Protein kinase superfamily
CMGC Ser/Thr protein kinase family
CDC2/CDKX subfamily

Sequence Similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Clinical Relevance8

Disease Involvement (2)

LissencephalyNeurodegeneration

Related Diseases

Obesity

Biomarker

Preclinical

Antibody (2)

CAB008909 HPA064535

Interaction Protein (12)

ENSG00000105401ENSG00000110092ENSG00000111276ENSG00000112576ENSG00000118816ENSG00000118971ENSG00000124762ENSG00000132646ENSG00000134057ENSG00000134508ENSG00000176749ENSG00000183318

Interaction Count

12

Interaction Dataset (4)

intact_biogrid_bioplexbiogrid_bioplexintact_biogridintact_biogrid_opencell

Supporting Publications1

PMID	Title	Abstract
35655072	Plasma extracellular vesicles bearing PD-L1, CD40, CD40L or TNF-RII are significantly reduced after treatment of AIDS-NHL.	Emerging evidence shows that tumor cells secrete extracellular vesicles (EVs) that carry bioactive cell surface markers, such as programmed death-ligand 1 (PD-L1), which can modulate immune responses and inhibit anti-tumor responses, potentially playing a role in lymphomagenesis and in promoting the growth of these cancers.

Entry name CDK5	UniProt ID Q00535	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteins