Protein detail
CDK5
Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)
Entry name CDK5 | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)
Protein Class
Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Enzymes
- Kinases:CMGC Ser/Thr protein kinases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
PSSALRE
Gene Description
Cyclin dependent kinase 5
Chromosome
7
Position
151053815-151057897
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificNeutrophilsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificbasophil
Function & Pathway
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Enzymes
- Kinases:CMGC Ser/Thr protein kinases
- Disease related genes
Cellular Component
- GO:0000307 cyclin-dependent protein kinase holoenzyme complex
- GO:0005634 nucleus
- GO:0005654 nucleoplasm
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005874 microtubule
- GO:0005886 plasma membrane
- GO:0014069 postsynaptic density
- GO:0016020 membrane
- GO:0016533 protein kinase 5 complex
- GO:0030027 lamellipodium
- GO:0030054 cell junction
- GO:0030175 filopodium
- GO:0030424 axon
- GO:0030425 dendrite
- GO:0030426 growth cone
- GO:0031594 neuromuscular junction
- GO:0043005 neuron projection
- GO:0043025 neuronal cell body
- GO:0043204 perikaryon
- GO:0098793 presynapse
Molecular Function
- GO:0002039 p53 binding
- GO:0004672 protein kinase activity
- GO:0004674 protein serine/threonine kinase activity
- GO:0004693 cyclin-dependent protein serine/threonine kinase activity
- GO:0005176 ErbB-2 class receptor binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0016301 kinase activity
- GO:0030549 acetylcholine receptor activator activity
- GO:0043125 ErbB-3 class receptor binding
- GO:0044024 histone H2AS1 kinase activity
- GO:0048156 tau protein binding
- GO:0050321 tau-protein kinase activity
- GO:0051879 Hsp90 protein binding
- GO:0106310 protein serine kinase activity
Biological Process
KEGG
Reactome
- R-hsa-9032845 activated ntrk2 signals through cdk5
- R-hsa-9909396 circadian clock
- R-hsa-399956 crmps in sema3a signaling
- R-hsa-180024 darpp 32 events
- R-hsa-9734009 defective intrinsic pathway for apoptosis
- R-hsa-9645723 diseases of programmed cell death
- R-hsa-9917777 epigenetic regulation by wdr5 containing histone modifying complexes
- R-hsa-212165 epigenetic regulation of gene expression
- R-hsa-9818564 epigenetic regulation of gene expression by mll3 and mll4 complexes
- R-hsa-983231 factors involved in megakaryocyte development and platelet production
- R-hsa-418594 g alpha i signalling events
- R-hsa-109582 hemostasis
- R-hsa-9675108 nervous system development
- R-hsa-9031628 ngf stimulated transcription
- R-hsa-9768919 npas4 regulates expression of target genes
- R-hsa-198725 nuclear events kinase and transcription factor activation
- R-hsa-111885 opioid signalling
- R-hsa-9931529 phosphorylation and nuclear translocation of bmal1 arntl and clock
- R-hsa-9931530 phosphorylation and nuclear translocation of the cry per kinase complex
- R-hsa-5633007 regulation of tp53 activity
- R-hsa-6804756 regulation of tp53 activity through phosphorylation
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-373755 semaphorin interactions
- R-hsa-372790 signaling by gpcr
- R-hsa-9006115 signaling by ntrk2 trkb
- R-hsa-166520 signaling by ntrks
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-9634815 transcriptional regulation by npas4
- R-hsa-3700989 transcriptional regulation by tp53
Canonical Pathways
- M3468 Naba ecm regulators
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
23 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CDK5 | VRK3 | Q8IV63 | S | 159 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| CDK5 | CDK7 | P50613 | S | 159 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:19399237ProtMapper:10896159ProtMapper:17490902ProtMapper:14586172 |
| CDK5 | NTRK2 | Q16620 | Y | 15 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:28316897ProtMapper:17341134 |
| CDK5 | NTRK1 | P04629 | Y | 15 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:17341134 |
| CDK5 | BDNF | P23560 | Y | 15 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:17341134 |
| CDK5 | SRC | P12931 | Y | 15 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:21442427 |
| CDK5 | SEMA3A | Q14563 | Y | 15 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:12372285 |
| CDK5 | CABLES1 | Q8TDN4 | Y | 15 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:10896159ProtMapper:24975575 |
| CDK5 | APP | P05067 | Y | 15 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:19700222 |
| CDK5 | CSNK1A1L | Q8N752 | S | 159 | phosphorylation | KEA | KEA:10500146 |
Ligand-Receptor Signaling
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
127 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains
Sequences
Length
292
Mass
33,304
Sequence
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q00535-1; Sequence=Displayed; Name=2; Synonyms=CDK5-SV; IsoId=Q00535-2; Sequence=VSP_041948
Alternative Sequence
105..136; Missing (in isoform 2)
3D Structural Models
Turn
24..26; 197..199; 224..226
Helix
46..55; 87..94; 100..119; 129..131; 145..147; 165..167; 170..173; 182..196; 208..219; 228..232; 248..250; 257..266; 271..273; 277..281; 284..286
Beta Strand
4..12; 14..23; 29..36; 40..42; 66..70; 76..81; 84..86; 132..134; 140..142; 287..289
3D Structure
X-ray crystallography (10)
Domain & Motif Annotations
Domain (FT)
4..286; Protein kinase
Protein Families
- Protein kinase superfamily
- CMGC Ser/Thr protein kinase family
- CDC2/CDKX subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Clinical Relevance
Disease Involvement
LissencephalyNeurodegeneration
Related Diseases
Biomarker
Preclinical
Drugs
GW441756XAZD-1080NULLRGB-286638CHEMBL:CHEMBL1406948HAEMATOXYLINCHEMBL:CHEMBL379975JNJ-7706621KENPAULLONEGO-6976PHA-767491OLOMOUCINELY-2090314PF-562271PP2DECYNIUM 22DINACICLIBSP-600125AZD5438NVP-TAE684PURPUROGALLINPALBOCICLIBCHEMBL:CHEMBL300389(RS)-ROSCOVITINECHEMBL:CHEMBL1276446RONICICLIBALSTERPAULLONESB-415286SOTRASTAURINCHEMBL:CHEMBL261692RG-1530ADAVOSERTIBTAMATINIBSELICICLIBALVOCIDIBFASUDILBAY 61-3606CHEMBL:CHEMBL1997335BMS-387032CYC-116AT-7519PHA-793887CENISERTIBAR-AO-14418
Interaction Protein
ENSG00000105401ENSG00000110092ENSG00000111276ENSG00000112576ENSG00000118816ENSG00000118971ENSG00000124762ENSG00000132646ENSG00000134057ENSG00000134508ENSG00000176749ENSG00000183318
Interaction Count
12
Interaction Dataset
intact_biogrid_bioplexbiogrid_bioplexintact_biogridintact_biogrid_opencell