Protein detail
CDK5
Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)
Entry name CDK5 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)
Protein Class (6)
Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function (7)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Enzymes
- Kinases:CMGC Ser/Thr protein kinases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
PSSALRE
Gene Description
Cyclin dependent kinase 5
Chromosome
7
Position
151053815-151057897
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization5
Tissue Specificbone marrowCell SpecificNeutrophilsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificbasophil
Function & Pathway8
Protein Function (7)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Enzymes
- Kinases:CMGC Ser/Thr protein kinases
- Disease related genes
Cellular Component (21)
- GO:0000307 cyclin-dependent protein kinase holoenzyme complex
- GO:0005634 nucleus
- GO:0005654 nucleoplasm
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005874 microtubule
- GO:0005886 plasma membrane
- GO:0014069 postsynaptic density
- GO:0016020 membrane
- GO:0016533 protein kinase 5 complex
Page 1 of 3
Molecular Function (15)
- GO:0002039 p53 binding
- GO:0004672 protein kinase activity
- GO:0004674 protein serine/threonine kinase activity
- GO:0004693 cyclin-dependent protein serine/threonine kinase activity
- GO:0005176 ErbB-2 class receptor binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0016301 kinase activity
- GO:0030549 acetylcholine receptor activator activity
- GO:0043125 ErbB-3 class receptor binding
Page 1 of 2
Biological Process (3)
KEGG (4)
Reactome (29)
- R-hsa-9032845 activated ntrk2 signals through cdk5
- R-hsa-9909396 circadian clock
- R-hsa-399956 crmps in sema3a signaling
- R-hsa-180024 darpp 32 events
- R-hsa-9734009 defective intrinsic pathway for apoptosis
- R-hsa-9645723 diseases of programmed cell death
- R-hsa-9917777 epigenetic regulation by wdr5 containing histone modifying complexes
- R-hsa-212165 epigenetic regulation of gene expression
- R-hsa-9818564 epigenetic regulation of gene expression by mll3 and mll4 complexes
- R-hsa-983231 factors involved in megakaryocyte development and platelet production
Page 1 of 3
Canonical Pathways (3)
- M3468 Naba ecm regulators
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence203
Enzyme-Mediated Modification (23)
23 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CDK5 | VRK3 | Q8IV63 | S | 159 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| CDK5 | CDK7 | P50613 | S | 159 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:19399237ProtMapper:10896159ProtMapper:17490902ProtMapper:14586172 |
| CDK5 | NTRK2 | Q16620 | Y | 15 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:28316897ProtMapper:17341134 |
| CDK5 | NTRK1 | P04629 | Y | 15 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:17341134 |
| CDK5 | BDNF | P23560 | Y | 15 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:17341134 |
| CDK5 | SRC | P12931 | Y | 15 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:21442427 |
| CDK5 | SEMA3A | Q14563 | Y | 15 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:12372285 |
| CDK5 | CABLES1 | Q8TDN4 | Y | 15 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:10896159ProtMapper:24975575 |
| CDK5 | APP | P05067 | Y | 15 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:19700222 |
| CDK5 | CSNK1A1L | Q8N752 | S | 159 | phosphorylation | KEA | KEA:10500146 |
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network (127)
127 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CDK5 | Q00535 | SYGP1 | Q96PV0 | Yes | Yes | No | SIGNOR | SIGNOR:26912996 |
| CDK5 | Q00535 | NDEL1 | Q9GZM8 | Yes | Yes | No | WangSparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperHPRD-phos | ProtMapper:24785679ProtMapper:18809722ProtMapper:26944284ProtMapper:12796778HPRD-phos:12796778ProtMapper:20068231HPRD-phos:20068231HPRD-phos:18669648HPRD-phos:19413330KEA:17242355SIGNOR:12796778ProtMapper:18669648KEA:12796778ProtMapper:19413330HPRD:12796778 |
| CDK5 | Q00535 | DLG4 | P78352 | Yes | Yes | Yes | REACH_ProtMapperSIGNORProtMapper | SIGNOR:28502042ProtMapper:28502042 |
| CDK5 | Q00535 | DLGP1 | O14490 | Yes | No | Yes | REACH_ProtMapperSIGNORProtMapper | ProtMapper:21829588SIGNOR:21829588ProtMapper:28502042 |
| CDK5 | Q00535 | DYL1 | P63167 | Yes | Yes | No | SIGNOR | SIGNOR:25452387 |
| CDK5 | Q00535 | ERBB2 | P04626 | Yes | Yes | No | iPTMnetSIGNORSparser_ProtMapperProtMapper | ProtMapper:12824184SIGNOR:26509276 |
| CDK5 | Q00535 | CTND2 | Q9UQB3 | Yes | Yes | No | REACH_ProtMapperSIGNORProtMapper | ProtMapper:28603076SIGNOR:20573893 |
| CDK5 | Q00535 | MK07 | Q13164 | Yes | Yes | No | PhosphoNetworksSparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperWangREACH_ProtMapper | ProtMapper:27735944SIGNOR:27735944 |
| CDK5 | Q00535 | SOX6 | P35712 | Yes | No | Yes | SIGNOR | SIGNOR:24662752 |
| CDK5 | Q00535 | AL1A1 | P00352 | Yes | Yes | No | REACH_ProtMapperSIGNORSparser_ProtMapperProtMapper | ProtMapper:29948941SIGNOR:29948941 |
Protein Complex Composition (41)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains12
Sequences
Length
292
Mass
33,304
Sequence
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q00535-1; Sequence=Displayed; Name=2; Synonyms=CDK5-SV; IsoId=Q00535-2; Sequence=VSP_041948
Alternative Sequence
105..136; Missing (in isoform 2)
3D Structural Models
Turn
24..26; 197..199; 224..226
Helix
46..55; 87..94; 100..119; 129..131; 145..147; 165..167; 170..173; 182..196; 208..219; 228..232; 248..250; 257..266; 271..273; 277..281; 284..286
Beta Strand
4..12; 14..23; 29..36; 40..42; 66..70; 76..81; 84..86; 132..134; 140..142; 287..289
3D Structure
X-ray crystallography (10)
Domain & Motif Annotations
Domain (FT)
4..286; Protein kinase
Protein Families (3)
- Protein kinase superfamily
- CMGC Ser/Thr protein kinase family
- CDC2/CDKX subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Clinical Relevance8
Disease Involvement (2)
LissencephalyNeurodegeneration
Related Diseases
Biomarker
Preclinical
Drugs (44)
GW441756XAZD-1080NULLRGB-286638CHEMBL:CHEMBL1406948HAEMATOXYLINCHEMBL:CHEMBL379975JNJ-7706621KENPAULLONEGO-6976PHA-767491OLOMOUCINELY-2090314PF-562271PP2DECYNIUM 22DINACICLIBSP-600125AZD5438NVP-TAE684PURPUROGALLINPALBOCICLIBCHEMBL:CHEMBL300389(RS)-ROSCOVITINECHEMBL:CHEMBL1276446RONICICLIBALSTERPAULLONESB-415286SOTRASTAURINCHEMBL:CHEMBL261692RG-1530ADAVOSERTIBTAMATINIBSELICICLIBALVOCIDIBFASUDILBAY 61-3606CHEMBL:CHEMBL1997335BMS-387032CYC-116AT-7519PHA-793887CENISERTIBAR-AO-14418
Interaction Protein (12)
ENSG00000105401ENSG00000110092ENSG00000111276ENSG00000112576ENSG00000118816ENSG00000118971ENSG00000124762ENSG00000132646ENSG00000134057ENSG00000134508ENSG00000176749ENSG00000183318
Interaction Count
12
Interaction Dataset (4)
intact_biogrid_bioplexbiogrid_bioplexintact_biogridintact_biogrid_opencell
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 35655072 | Plasma extracellular vesicles bearing PD-L1, CD40, CD40L or TNF-RII are significantly reduced after treatment of AIDS-NHL. | Emerging evidence shows that tumor cells secrete extracellular vesicles (EVs) that carry bioactive cell surface markers, such as programmed death-ligand 1 (PD-L1), which can modulate immune responses and inhibit anti-tumor responses, potentially playing a role in lymphomagenesis and in promoting the growth of these cancers. |