Protein detail
BORG5
Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum protein MSE55)
Entry name BORG5 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum protein MSE55)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
Borg5CEP1MSE55
Gene Description
CDC42 effector protein 1
Chromosome
22
Position
37560480-37569405
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificMegakaryocytesSingle-Nuclei Brain Specificpericyte
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (7)
Molecular Function (3)
Biological Process (3)
Reactome (9)
- R-hsa-9013148 cdc42 gtpase cycle
- R-hsa-9013149 rac1 gtpase cycle
- R-hsa-9013404 rac2 gtpase cycle
- R-hsa-9013423 rac3 gtpase cycle
- R-hsa-9013408 rhog gtpase cycle
- R-hsa-9013409 rhoj gtpase cycle
- R-hsa-9013406 rhoq gtpase cycle
- R-hsa-9012999 rho gtpase cycle
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence11
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CDC42EP1 | MAPK1 | P28482 | S | 195 | phosphorylation | SIGNOR | SIGNOR:22028470 |
| CDC42EP1 | MAPK1 | P28482 | S | 113 | phosphorylation | SIGNOR | SIGNOR:22028470 |
| CDC42EP1 | PRKACB | P22694 | S | 121 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | LOCATE | |||||
| extracellular | extracellular | OmniPath | |||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
391
Mass
40,295
Sequence
MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q00587-1; Sequence=Displayed; Name=2; IsoId=Q00587-2; Sequence=VSP_004325
Alternative Sequence
258..264; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
167..179; Basic and acidic residues; 236..270; Low complexity; 327..338; Basic and acidic residues; 364..377; Polar residues; 381..391; Acidic residues
Repeat
220..226; 1; 227..233; 2; 234..240; 3; 241..247; 4; 248..254; 5; 255..261; 6; 262..268; 7; 269..275; 8
Domain (CC)
The CRIB domain mediates interaction with CDC42.
Domain (FT)
38..52; CRIB
Region
163..189; Disordered; 220..275; 8 X 7 AA tandem repeats of [PT]-[AT]-A-[ENT]-[PT]-[PTS]-[AG]; 221..338; Disordered; 354..391; Disordered
Protein Families
BORG/CEP family
Sequence Similarities
Belongs to the BORG/CEP family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No related sentences available |