Protein detail
ILRL1
Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Protein ST2)
Entry name ILRL1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification Candidate cardiovascular disease genesEnzymesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Protein ST2)
Protein Class (6)
Candidate cardiovascular disease genesEnzymesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function (5)
- Predicted intracellular proteins
- Candidate cardiovascular disease genes
- Enzymes
- Predicted secreted proteins
- ENZYME proteins:Hydrolases
Transmembrane
329..349; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
DER4FIT-1IL33RST2ST2LST2VT1
Gene Description
Interleukin 1 receptor like 1
Chromosome
2
Position
102311502-102352037
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization2
Tissue SpecificbrainCell SpecificBrain excitatory neurons
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- Candidate cardiovascular disease genes
- Enzymes
- Predicted secreted proteins
- ENZYME proteins:Hydrolases
Cellular Component (6)
Molecular Function (7)
Biological Process (3)
Reactome (5)
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence78
Ligand-Receptor Signaling (67)
67 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | Yes | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
Regulatory Interaction Network (7)
7 records.
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| IL33 receptor-ligand complex | IL1RAPIL1RL1IL33 | O95760Q01638Q9NPH3 | 1:1:1 | ComplexPortal | PDB:4KC3 | 27091974147552922398017027640624 |
| IL33-IL1RL1 decoy complex | IL1RL1IL33 | O95760Q01638 | 1:1 | ComplexPortalPDB | PDB:4kc3 | 27091974147552922398017027640624 |
| IL33_receptor | IL1RAPIL1RL1 | Q01638Q9NPH3 | 1:1 | Guide2PharmaCellChatDBCellPhoneDBICELLNETCellinker | CellPhoneDB:IL33_receptor | 2433202920959797 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains14
Sequences
Length
556
Mass
63,358
Sequence
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPLAAQKQ
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=A; Synonyms=ST2L; IsoId=Q01638-1; Sequence=Displayed; Name=B; Synonyms=ST2S; IsoId=Q01638-2; Sequence=VSP_002666, VSP_002667; Name=C; Synonyms=ST2V; IsoId=Q01638-3; Sequence=VSP_002664, VSP_002665; Name=4; IsoId=Q01638-4; Sequence=VSP_054933, VSP_002666, VSP_002667
Alternative Sequence
1..117; Missing (in isoform 4); 204..259; DEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKIT -> VWCQSFCKLKKSLIFSNTHWIQSLMRGFVMVYYGVHKCCRVVFNLCLQYFQHHQWP (in isoform C); 260..556; Missing (in isoform C); 324..328; IDHHS -> SKECF (in isoform B and isoform 4); 329..556; Missing (in isoform B and isoform 4)
3D Structural Models
Turn
156..158
Helix
79..81; 136..138; 173..175; 295..297
Beta Strand
24..27; 32..35; 44..49; 63..68; 71..76; 83..90; 95..105; 121..123; 125..127; 130..132; 146..149; 159..162; 165..170; 177..189; 191..202; 209..216; 219..221; 234..242; 248..253; 265..269; 281..288; 301..306; 311..317
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (CC)
The TIR domain mediates NAD(+) hydrolase (NADase) activity. Self-association of TIR domains is required for NADase activity.
Domain (FT)
19..103; Ig-like C2-type 1; 114..197; Ig-like C2-type 2; 212..319; Ig-like C2-type 3; 375..535; TIR
Region
198..211; Flexible linker
Protein Families
Interleukin-1 receptor family
Sequence Similarities
Belongs to the interleukin-1 receptor family.
Clinical Relevance4
Related Diseases (2)
Biomarker
Phase 2; Phase 3
Drugs
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No abstract available |