Protein detail

ILRL1

Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Protein ST2)

Entry name ILRL1	UniProt ID Q01638	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 1	Protein classification Candidate cardiovascular disease genesEnzymesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Protein ST2)

Protein Class (6)

Candidate cardiovascular disease genesEnzymesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins

Protein Function (5)

Predicted intracellular proteins
Candidate cardiovascular disease genes
Enzymes
Predicted secreted proteins
ENZYME proteins:Hydrolases

Transmembrane

329..349; Helical

Transmembrane Count

Ensembl

ENSG00000115602

Entrez Gene Symbol

IL1RL1

Gene Synonym (7)

DER4FIT-1IL33RST2ST2LST2VT1

Gene Description

Interleukin 1 receptor like 1

Chromosome

Position

102311502-102352037

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Tissue SpecificbrainCell SpecificBrain excitatory neurons

Function & Pathway7

Protein Function (5)

Predicted intracellular proteins
Candidate cardiovascular disease genes
Enzymes
Predicted secreted proteins
ENZYME proteins:Hydrolases

Cellular Component (6)

Molecular Function (7)

Biological Process (3)

KEGG

hsa04060 Cytokine-cytokine receptor interaction

Reactome (5)

Mediation Categories (5)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence78

Ligand-Receptor Signaling (67)

67 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
interleukin	receptor	HGNC	No	Yes	Yes	Yes	No
tir_domain	receptor	HGNC	No	Yes	Yes	Yes	No
receptor	receptor	HGNC	No	Yes	Yes	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	Yes	Yes	No
transmembrane_phobius	transmembrane_predicted	Almen2009	No	No	Yes	Yes	No
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	Yes	Yes	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	Yes	Yes	No

Page 7 of 7Previous

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ILRL1	Q01638	IL1AP	Q9NPH3	Yes	Yes	No	InnateDBSIGNOR	SIGNOR:35238669 InnateDB:19836339
IL33	O95760	ILRL1	Q01638	Yes	Yes	No	Guide2PharmaCellTalkDBUniProt_LRdbSIGNORconnectomeDB2020HPRDHINTBaccin2019InnateDBDIPSPIKE_LCLRdb	CellTalkDB:23980170 connectomeDB2020:20926795 SPIKE_LC:17145710 InnateDB:18450470 SPIKE_LC:16286016 connectomeDB2020:16286016 SIGNOR:16286016 HPRD:16286016 HINT:23980170 HINT:19439663 DIP:19439663 HINT:16286016 InnateDB:19439663 InnateDB:23980170 connectomeDB2020:19996325 HINT:19559631 InnateDB:19559631 Baccin2019:29247993 connectomeDB2020:29763370 InnateDB:19836339
ILRL1	Q01638	TRAF6	Q9Y4K3	Yes	Yes	No	SPIKE_LCSIGNOR	SPIKE_LC:16286016 SPIKE_LC:17145710 SIGNOR:16286016
ILRL1	Q01638	M3K7	O43318	Yes	Yes	No	SIGNOR	SIGNOR:35238669
ILRL1	Q01638	IRAK4	Q9NWZ3	Yes	Yes	No	InnateDBHINTSIGNORSPIKE_LC	HINT:15084582 InnateDB:12538665 SPIKE_LC:17145710 HINT:12538665 SIGNOR:16286016 HINT:16286016 InnateDB:16286016 InnateDB:15084582
ILRL1	Q01638	IRAK1	P51617	Yes	Yes	No	SIGNOR	SIGNOR:16286016
ILRL1	Q01638	MYD88	Q99836	Yes	Yes	No	HPRDSPIKE_LCSIGNOR	SPIKE_LC:17145710 SIGNOR:16286016 HPRD:15004556

Protein Complex Composition (3)

3 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
IL33 receptor-ligand complex	IL1RAP IL1RL1 IL33	O95760 Q01638 Q9NPH3	1:1:1	ComplexPortal	PDB:4KC3	27091974 14755292 23980170 27640624
IL33-IL1RL1 decoy complex	IL1RL1 IL33	O95760 Q01638	1:1	ComplexPortalPDB	PDB:4kc3	27091974 14755292 23980170 27640624
IL33_receptor	IL1RAP IL1RL1	Q01638 Q9NPH3	1:1	Guide2PharmaCellChatDBCellPhoneDBICELLNETCellinker	CellPhoneDB:IL33_receptor	24332029 20959797

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
PRotein Organic Solvent Precipitation；Differential Ultracentrifugation	Mass spectrometry	1	32384937

Sequence, Structure & Domains14

Sequences

Length

556

Mass

63,358

Sequence

MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPLAAQKQ

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=A; Synonyms=ST2L; IsoId=Q01638-1; Sequence=Displayed; Name=B; Synonyms=ST2S; IsoId=Q01638-2; Sequence=VSP_002666, VSP_002667; Name=C; Synonyms=ST2V; IsoId=Q01638-3; Sequence=VSP_002664, VSP_002665; Name=4; IsoId=Q01638-4; Sequence=VSP_054933, VSP_002666, VSP_002667

Alternative Sequence

1..117; Missing (in isoform 4); 204..259; DEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKIT -> VWCQSFCKLKKSLIFSNTHWIQSLMRGFVMVYYGVHKCCRVVFNLCLQYFQHHQWP (in isoform C); 260..556; Missing (in isoform C); 324..328; IDHHS -> SKECF (in isoform B and isoform 4); 329..556; Missing (in isoform B and isoform 4)

3D Structural Models

Turn

156..158

Helix

79..81; 136..138; 173..175; 295..297

Beta Strand

24..27; 32..35; 44..49; 63..68; 71..76; 83..90; 95..105; 121..123; 125..127; 130..132; 146..149; 159..162; 165..170; 177..189; 191..202; 209..216; 219..221; 234..242; 248..253; 265..269; 281..288; 301..306; 311..317

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Domain (CC)

The TIR domain mediates NAD(+) hydrolase (NADase) activity. Self-association of TIR domains is required for NADase activity.

Domain (FT)

19..103; Ig-like C2-type 1; 114..197; Ig-like C2-type 2; 212..319; Ig-like C2-type 3; 375..535; TIR

Region

198..211; Flexible linker

Protein Families

Interleukin-1 receptor family

Sequence Similarities

Belongs to the interleukin-1 receptor family.

Clinical Relevance4

Related Diseases (2)

Asthma Chronic obstructive pulmonary disease

Biomarker

Phase 2; Phase 3

Drugs

ASTEGOLIMAB

Antibody (2)

HPA007406 HPA007917

Supporting Publications2

PMID	Title	Abstract
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
39207047	The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.	No abstract available