Protein detail
KPCE
Protein kinase C epsilon type (EC 2.7.11.13) (nPKC-epsilon)
Entry name KPCE | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesEnzymesFDA approved drug targetsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Protein kinase C epsilon type (EC 2.7.11.13) (nPKC-epsilon)
Protein Class (4)
Cancer-related genesEnzymesFDA approved drug targetsPredicted intracellular proteins
Protein Function (6)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:AGC Ser/Thr protein kinases
- FDA approved drug targets:Small molecule drugs
Ensembl
Entrez Gene Symbol
Gene Description
Protein kinase C epsilon
Chromosome
2
Position
45651345-46187990
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificliverCell SpecificCholangiocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:AGC Ser/Thr protein kinases
- FDA approved drug targets:Small molecule drugs
Cellular Component (12)
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005739 mitochondrion
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0045111 intermediate filament cytoskeleton
- GO:0045202 synapse
Page 1 of 2
Molecular Function (14)
- GO:0003785 actin monomer binding
- GO:0004672 protein kinase activity
- GO:0004674 protein serine/threonine kinase activity
- GO:0004697 diacylglycerol-dependent serine/threonine kinase activity
- GO:0004699 diacylglycerol-dependent, calcium-independent serine/threonine kinase activity
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0008047 enzyme activator activity
- GO:0019899 enzyme binding
- GO:0030546 signaling receptor activator activity
Page 1 of 2
Biological Process (3)
KEGG (13)
- hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04530 Tight junction
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04750 Inflammatory mediator regulation of TRP channels
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04930 Type II diabetes mellitus
- KEGG:hsa04931 Insulin resistance
Page 1 of 2
Reactome (14)
- R-hsa-1489509 dag and ip3 signaling
- R-hsa-114508 effects of pip2 hydrolysis
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-416476 g alpha q signalling events
- R-hsa-418597 g alpha z signalling events
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-2029485 role of phospholipids in phagocytosis
Page 1 of 2
Canonical Pathways (3)
- M184 Pid ecadherin keratinocyte pathway
- M72 Pid nectin pathway
- M156 Pid ecadherin nascent aj pathway
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence94
Enzyme-Mediated Modification (23)
23 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PRKCE | INS | P01308 | S | 729 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:23673367 |
| PRKCE | PMAIP1 | Q13794 | S | 729 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:17091491 |
| PRKCE | PRKACB | P22694 | S | 729 | phosphorylation | KEA | KEA:17570479 |
Page 3 of 3Previous
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Page 2 of 2Previous
Regulatory Interaction Network (55)
55 records.
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 29045505 |
Sequence, Structure & Domains
Sequences
Length
737
Mass
83,674
Sequence
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP
3D Structural Models
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Motif
223..228; Interaction with actin
Zinc Finger
169..220; Phorbol-ester/DAG-type 1; 242..292; Phorbol-ester/DAG-type 2
Domain (CC)
The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.
Domain (FT)
1..117; C2; 408..668; Protein kinase; 669..737; AGC-kinase C-terminal
Region
325..356; Disordered; 370..398; Disordered
Protein Families (3)
- Protein kinase superfamily
- AGC Ser/Thr protein kinase family
- PKC subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
Clinical Relevance
Disease Involvement (2)
Cancer-related genesFDA approved drug targets
Related Diseases (5)
Biomarker
Phase 2; Approved; Discontinued in Phase 1; Terminated
Drug Targets
FDA approved drug targets
Drugs (21)
Interaction Protein (3)
ENSG00000096384ENSG00000146648ENSG00000164924
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |