Protein detail
KPCE
Protein kinase C epsilon type (EC 2.7.11.13) (nPKC-epsilon)
Protein symbol KPCE | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Cancer-related genesEnzymesFDA approved drug targetsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Protein kinase C epsilon type (EC 2.7.11.13) (nPKC-epsilon)
Protein Class
Cancer-related genesEnzymesFDA approved drug targetsPredicted intracellular proteins
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:AGC Ser/Thr protein kinases
- FDA approved drug targets:Small molecule drugs
Ensembl
Entrez Gene Symbol
Gene Description
Protein kinase C epsilon
Chromosome
2
Position
45651345-46187990
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue SpecificliverCell SpecificCholangiocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:AGC Ser/Thr protein kinases
- FDA approved drug targets:Small molecule drugs
Cellular Component
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005739 mitochondrion
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0045111 intermediate filament cytoskeleton
- GO:0045202 synapse
- GO:0048471 perinuclear region of cytoplasm
- GO:0071944 cell periphery
Molecular Function
- GO:0003785 actin monomer binding
- GO:0004672 protein kinase activity
- GO:0004674 protein serine/threonine kinase activity
- GO:0004697 diacylglycerol-dependent serine/threonine kinase activity
- GO:0004699 diacylglycerol-dependent, calcium-independent serine/threonine kinase activity
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0008047 enzyme activator activity
- GO:0019899 enzyme binding
- GO:0030546 signaling receptor activator activity
- GO:0035276 ethanol binding
- GO:0046872 metal ion binding
- GO:0071889 14-3-3 protein binding
- GO:0106310 protein serine kinase activity
Biological Process
KEGG
- hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04530 Tight junction
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04750 Inflammatory mediator regulation of TRP channels
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04930 Type II diabetes mellitus
- KEGG:hsa04931 Insulin resistance
- KEGG:hsa04933 AGE-RAGE signaling pathway in diabetic complications
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05206 MicroRNAs in cancer
Reactome
- R-hsa-1489509 dag and ip3 signaling
- R-hsa-114508 effects of pip2 hydrolysis
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-416476 g alpha q signalling events
- R-hsa-418597 g alpha z signalling events
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-2029485 role of phospholipids in phagocytosis
- R-hsa-1250196 shc1 events in erbb2 signaling
- R-hsa-1227986 signaling by erbb2
- R-hsa-372790 signaling by gpcr
- R-hsa-9006934 signaling by receptor tyrosine kinases
Canonical Pathways
- M184 Pid ecadherin keratinocyte pathway
- M72 Pid nectin pathway
- M156 Pid ecadherin nascent aj pathway
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
23 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PRKCE | PDPK1 | O15530 | T | 566 | phosphorylation | SIGNORProtMapperHPRDdbPTMKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:10945988HPRD:11062054KEA:12640464KEA:11964154KEA:11062054ProtMapper:11964154SIGNOR:11964154phosphoELM:11964154HPRD:10945988HPRD:12640464dbPTM:11964154 |
| PRKCE | GSK3B | P49841 | S | 346 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:18604201ProtMapper:20350291SIGNOR:18604201 |
| PRKCE | GSK3B | P49841 | S | 368 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:20350291 |
| PRKCE | MAPK11 | Q15759 | S | 350 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| PRKCE | MAPK14 | Q16539 | S | 350 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| PRKCE | MTOR | P42345 | T | 710 | phosphorylation | PhosphoSite | |
| PRKCE | MTOR | P42345 | S | 729 | phosphorylation | REACH_ProtMapperPhosphoSiteSparser_ProtMapperProtMapper | ProtMapper:26893192 |
| PRKCE | MTOR | P42345 | T | 566 | phosphorylation | PhosphoSite | |
| PRKCE | PRKCA | P17252 | S | 316 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| PRKCE | PRKCA | P17252 | S | 234 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Page 1 of 3Next
Ligand-Receptor Signaling
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Page 2 of 2Previous
Regulatory Interaction Network
55 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCE | Q02156 | ATF2 | P15336 | Yes | Yes | No | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:24727247ProtMapper:30497386ProtMapper:25728676ProtMapper:22304920PhosphoSite:22304920ProtMapper:24357804ProtMapper:25545367SIGNOR:22304920PhosphoSite:26645581 |
| KPCE | Q02156 | KS6B2 | Q9UBS0 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKinexus_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:12529391KEA:12529391HPRD:16810323phosphoELM:12529391SIGNOR:12529391 |
| KPCE | Q02156 | OPRD | P41143 | Yes | No | No | phosphoELM_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | KEA:11085981ProtMapper:11085981HPRD-phos:11085981HPRD:11085981SIGNOR:11085981 |
| KPCE | Q02156 | GLSK | O94925 | Yes | Yes | No | PhosphoSiteSIGNOR | SIGNOR:29515166PhosphoSite:29515166 |
| KPCE | Q02156 | GSTP1 | P09211 | Yes | Yes | No | SIGNOR | SIGNOR:15604283 |
| KPCE | Q02156 | BAD | Q92934 | Yes | No | Yes | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:20179209SIGNOR:20179209 |
| KPCE | Q02156 | NANOG | Q9H9S0 | Yes | Yes | No | Sparser_ProtMapperPhosphoSite_norefSIGNORiPTMnetProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:23708658ProtMapper:24727247PhosphoSite:30728896PhosphoSite:24678451ProtMapper:23708658SIGNOR:23708658 |
| PDPK1 | O15530 | KPCE | Q02156 | Yes | Yes | No | WangiPTMnetPhosphoPointSIGNORProtMapperHPRDdbPTMPhosphoSite_KEAKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperHPRD-phosPhosphoSite_ProtMapper | ProtMapper:11062054HPRD-phos:12640464KEA:10945988HPRD:11062054KEA:12640464KEA:11964154KEA:11062054ProtMapper:11964154ProtMapper:17434141SIGNOR:11964154HPRD-phos:10945988HPRD:10945988phosphoELM:11964154HPRD:12640464ProtMapper:12640464ProtMapper:10945988dbPTM:11964154HPRD-phos:11062054 |
| SIN1 | Q9BPZ7 | KPCE | Q02156 | Yes | Yes | No | SIGNOR | SIGNOR:21806543 |
| KPCE | Q02156 | B3A3 | P48751 | Yes | Yes | No | phosphoELM_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDRLIMS-P_ProtMapperPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapper | KEA:11739292HPRD:11739292SIGNOR:11739292phosphoELM:11739292ProtMapper:11739292 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 29045505 |
Sequence, Structure & Domains
Sequences
Length
737
Mass
83,674
Sequence
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP
3D Structural Models
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Motif
223..228; Interaction with actin
Zinc Finger
169..220; Phorbol-ester/DAG-type 1; 242..292; Phorbol-ester/DAG-type 2
Domain (CC)
The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.
Domain (FT)
1..117; C2; 408..668; Protein kinase; 669..737; AGC-kinase C-terminal
Region
325..356; Disordered; 370..398; Disordered
Protein Families
- Protein kinase superfamily
- AGC Ser/Thr protein kinase family
- PKC subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
Clinical Relevance
Disease Involvement
Cancer-related genesFDA approved drug targets
Related Diseases
Biomarker
Phase 2; Approved; Discontinued in Phase 1; Terminated
Drug Targets
FDA approved drug targets
Drugs
Interaction Protein
ENSG00000096384ENSG00000146648ENSG00000164924
Interaction Count
3
Interaction Dataset
intact_biogrid