Protein detail
LGUL
Lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase)
Protein symbol LGUL | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Cancer-related genesEnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase)
Protein Class
Cancer-related genesEnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteins
Protein Function
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
- ENZYME proteins:Lyases
Ensembl
Entrez Gene Symbol
Gene Synonym
GLOD1
Gene Description
Glyoxalase I
Chromosome
6
Position
38675925-38703145
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificskin 1Cell SpecificSuprabasal keratinocytes
Function & Pathway
Protein Function
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
- ENZYME proteins:Lyases
Cellular Component
Molecular Function
Reactome
Mediation Categories
Clinical-translation mediationImmune mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| GLO1 | CAMK2A | Q9UQM7 | T | 107 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| GLO1 | CAMK2D | Q13557 | T | 107 | phosphorylation | PhosphoSite | |
| GLO1 | TNF | P01375 | T | 107 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:19199007 |
Ligand-Receptor Signaling
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
12 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FGFR3 | P22607 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| FGR | P09769 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| YES | P07947 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| FGFR4 | P22455 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| LYN | P07948 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| KCC2A | Q9UQM7 | LGUL | Q04760 | Yes | Yes | No | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:33459186PhosphoSite:32966793PhosphoSite:19199007SIGNOR:32966793 |
| FGFR2 | P21802 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| EPHA5 | P54756 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| VGFR3 | P35916 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
| ABL1 | P00519 | LGUL | Q04760 | Yes | Yes | No | SIGNOR | SIGNOR:34838714 |
Page 1 of 2Next
Protein Complex Composition
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GLO1NUDT9TIPRL | O75663Q04760Q9BW91 | 0:0:0 | hu.MAP2 | |||
| AGLGLO1ITPAPNP | P00491P35573Q04760Q9BY32 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_233 | ||
| AKR1B1GLO1 | P15121Q04760 | 0:0 | hu.MAP | |||
| GLO1 | Q04760 | 4 | PDB | PDB:1froPDB:1qipPDB:3w0tPDB:3vw9PDB:7wt0PDB:1qinPDB:7wszPDB:1bh5PDB:3w0uPDB:7wt2PDB:7wt1 | ||
| GLO1NAXDNDUFAF7TRAP1 | Q04760Q12931Q7L592Q8IW45 | 0:0:0:0 | hu.MAP2 | |||
| GLO1NUDT9 | Q04760Q9BW91 | 0:0 | hu.MAP2 | |||
| GLO1GLOD4 | Q04760Q9HC38 | 0:0 | hu.MAP | |||
| GLO1GRHPR | Q04760Q9UBQ7 | 0:0 | hu.MAP |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation；Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
184
Mass
20,778
Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q04760-1; Sequence=Displayed; Name=2; IsoId=Q04760-2; Sequence=VSP_041632
Alternative Sequence
105..119; Missing (in isoform 2)
3D Structural Models
Turn
64..67
Helix
13..18; 25..27; 42..51; 78..80; 85..92; 107..109; 135..144; 177..179; 181..183
Beta Strand
31..38; 56..63; 68..75; 95..104; 118..122; 124..131; 149..151; 155..158; 162..165; 171..175
3D Structure
X-ray crystallography (11)
Domain & Motif Annotations
Domain (FT)
31..177; VOC
Protein Families
Glyoxalase I family
Sequence Similarities
Belongs to the glyoxalase I family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Related Diseases
Biomarker
Phase 2