EV MemProt Atlas

Basic Information

Protein Names

Tyrosine-protein kinase BTK (EC 2.7.10.2) (Agammaglobulinemia tyrosine kinase) (ATK) (B-cell progenitor kinase) (BPK) (Bruton tyrosine kinase)

Protein Class

Cancer-related genesDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins
ENZYME proteins:Transferases
Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
Human disease related genes:Immune system diseases:Primary immunodeficiency
Enzymes
Cancer-related genes
Kinases:Tyr protein kinases
Disease related genes
FDA approved drug targets:Small molecule drugs

Ensembl

ENSG00000010671

Entrez Gene Symbol

BTK

Gene Synonym

AGMX1ATKIMD1PSCTK1XLA

Gene Description

Bruton tyrosine kinase

Chromosome

X

Position

101349338-101390796

Frequency

9

EVMP Score

0.63

Fluorescence & Localization

Tissue SpecificbrainCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificcommitted oligodendrocyte precursor

Function & Pathway

Protein Function

Predicted intracellular proteins
ENZYME proteins:Transferases
Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
Human disease related genes:Immune system diseases:Primary immunodeficiency
Enzymes
Cancer-related genes
Kinases:Tyr protein kinases
Disease related genes
FDA approved drug targets:Small molecule drugs

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Canonical Pathways

M83 Pid cdc42 reg pathway
M241 Pid rac1 reg pathway
M68 Pid rhoa reg pathway

Mediation Categories

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

23 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
BTK	PTPRG	P23470	Y	223	dephosphorylation	SIGNOR	SIGNOR:25624455
BTK	PTPRG	P23470	Y	223	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:25624455
BTK	AKT1	P31749	S	51	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
BTK	AKT1	P31749	T	495	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
BTK	CD40	P25942	Y	223	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:21074890
BTK	BCR	P11274	Y	223	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:21074890
BTK	BCR	P11274	Y	551	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:25944695
BTK	EPO	P01588	Y	223	phosphorylation	REACH_ProtMapperSparser_ProtMapperProtMapper	ProtMapper:15007095
BTK	KITLG	P21583	Y	223	phosphorylation	Sparser_ProtMapperProtMapper	ProtMapper:15007095
BTK	BLNK	Q8WV28	Y	551	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:11226282

Page 2 of 3Previous Next

Ligand-Receptor Signaling

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
receptor	receptor	scConnect	No	Yes	No	No	No

Page 2 of 2Previous

Regulatory Interaction Network

30 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
BTK	Q06187	TEC	P42680	Yes	Yes	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAKinexus_KEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:12573241 HPRD:8630736 phosphoELM:12573241 KEA:12573241 SIGNOR:12573241 HPRD:12445832 HPRD:12573241 HPRD:11598012 HPRD:8629002
SRC	P12931	BTK	Q06187	Yes	Yes	No	WangSparser_ProtMapperiPTMnetSIGNORProtMapperKinexus_KEAKEASIGNOR_ProtMapperREACH_ProtMapper	KEA:10051622 ProtMapper:29455639 ProtMapper:23170196 ProtMapper:9052864 ProtMapper:31949019 ProtMapper:10196129 ProtMapper:23449308 ProtMapper:8629002 ProtMapper:19109164 ProtMapper:8630736 SIGNOR:8629002 ProtMapper:26165234
BTK	Q06187	STAT3	P40763	Yes	No	Yes	InnateDBSIGNOR	SIGNOR:9751072 InnateDB:17367410
BTK	Q06187	DDX41	Q9UJV9	Yes	Yes	No	Sparser_ProtMapperPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSite_ProtMapper	ProtMapper:28744851 SIGNOR:25704810 ProtMapper:28625530 ProtMapper:25704810
KSYK	P43405	BTK	Q06187	Yes	Yes	No	KEGG-MEDICUSHPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperdbPTMPhosphoSite_KEAHPRDKinexus_KEAWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperSparser_ProtMapperHPRD-phos	HPRD-phos:11598012 ProtMapper:28359287 ProtMapper:29455639 KEA:11226282 KEA:11598012 ProtMapper:8629002 dbPTM:9012831 SIGNOR:11226282 ProtMapper:8630736 KEA:8630736 KEA:10051622 ProtMapper:28368423 dbPTM:19369195 ProtMapper:22449073 dbPTM:18083107 HPRD:8629002 ProtMapper:11598012 ProtMapper:28088788 HPRD:8630736 ProtMapper:33154951 dbPTM:8630736 ProtMapper:34609725 HPRD-phos:11226282 HPRD:11598012 ProtMapper:11226282 KEA:8629002 HPRD-phos:8629002 HPRD-phos:8630736 HPRD:11226282
JAK2	O60674	BTK	Q06187	Yes	Yes	No	WangSIGNOR	SIGNOR:15007095
BTK	Q06187	IKZF1	Q13422	Yes	Yes	No	Sparser_ProtMapperPhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperRLIMS-P_ProtMapperInnateDBREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	InnateDB:23977012 ProtMapper:23977012 PhosphoSite:23977012 SIGNOR:23977012
BTK	Q06187	STA5A	P42229	Yes	Yes	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEAInnateDBSIGNOR_ProtMapperHPRD-phos	HPRD-phos:7925280 KEA:8617237 HPRD:8617237 HPRD-phos:11413148 KEA:7925280 ProtMapper:11413148 HPRD:7925280 ProtMapper:17016520 KEA:17081983 SIGNOR:11413148 ProtMapper:17389395 KEA:11641791 HPRD-phos:8617237 ProtMapper:7925280 KEA:11413148 HPRD:11413148 InnateDB:11413148 HPRD-phos:17389395 ProtMapper:16497976 ProtMapper:8617237 HPRD-phos:16497976 HPRD-phos:17016520
BTK	Q06187	WIPF1	O43516	Yes	Yes	No	SIGNORSparser_ProtMapperProtMapper	ProtMapper:25413351 SIGNOR:25413351
PK3CA	P42336	BTK	Q06187	Yes	Yes	No	WangSIGNOR	SIGNOR:10201980

Page 2 of 3Previous Next

Protein Complex Composition

7 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
HT_SC_Cluster107	IBTK RAN RANGRF RCC1	P18754 P62826 Q9HD47 Q9P2D0	1:1:1:1	Compleat	Compleat:HC2468
	CSE1L IBTK KPNA4 KPNB1 NUP153 NUTF2 RAN RANBP1 RANBP3 RCC1 SNRPN UBC XPO1	O00629 O14980 P0CG48 P18754 P43487 P49790 P55060 P61970 P62826 P63162 Q14974 Q9H6Z4 Q9P2D0	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9631
	IBTK POP7 RPP25L	O75817 Q8N5L8 Q9P2D0	0:0:0	hu.MAP
	BTK	Q06187	2	PDB	PDB:1k2pPDB:6yyfPDB:6yykPDB:6nzmPDB:6yygPDB:5zz4PDB:6tfpPDB:4nwmPDB:5bpyPDB:7l5pPDB:6tt2PDB:6x3oPDB:1btkPDB:8yvvPDB:1bwnPDB:6tsePDB:5fbnPDB:2z0pPDB:3p08PDB:4yhfPDB:6s90PDB:5jrsPDB:6tvnPDB:5xyzPDB:1b55PDB:6tuhPDB:5j87
	BIRC2 BTK	Q06187 Q13490	2:2	PDB	PDB:6w8iPDB:8dsoPDB:6w7o
	ANKRD54 BTK	Q06187 Q6NXT1	0:0	hu.MAP2
	IBTK RPP25L	Q8N5L8 Q9P2D0	0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass Spectrometry	1	32384937

Sequence, Structure & Domains

Sequences

Length

659

Mass

76,281

Sequence

MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES

Alternative Products

Event=Alternative promoter usage; Named isoforms=2; Name=BTK-A; IsoId=Q06187-1; Sequence=Displayed; Name=BTK-C; IsoId=Q06187-2; Sequence=VSP_053838

Alternative Sequence

1; M -> MASWSIQQMVIGCPLCGRHCSGGEHTGELQKEEAM (in isoform BTK-C)

3D Structural Models

Turn

44..47; 153..155; 212..215; 257..259; 266..268; 340..342; 422..424; 434..436; 524..526; 592..594; 597..600

Helix

58..60; 75..77; 93..96; 118..132; 288..298; 355..362; 393..395; 399..401; 439..450; 482..487; 489..491; 495..514; 542..545; 549..551; 561..563; 566..571; 576..591; 603..611; 624..632; 638..640; 644..657

Beta Strand

5..13; 15..17; 19..21; 25..32; 34..43; 48..57; 63..66; 82..85; 100..106; 109..117; 140..142; 149..152; 165..167; 218..223; 228..232; 240..242; 248..252; 261..265; 279..282; 303..308; 310..313; 315..321; 330..335; 337..339; 344..347; 352..354; 369..371; 373..376; 402..410; 412..414; 415..421; 425..431; 460..464; 466..469; 471..474; 527..529; 535..537; 556..559

3D Structure

NMR spectroscopy (4); X-ray crystallography (129)

Domain & Motif Annotations

Motif

581..588; CAV1-binding

Zinc Finger

135..171; Btk-type

Domain (CC)

The PH domain mediates the binding to inositol polyphosphate and phosphoinositides, leading to its targeting to the plasma membrane. It is extended in the BTK kinase family by a region designated the TH (Tec homology) domain, which consists of about 80 residues preceding the SH3 domain.

Domain (FT)

3..133; PH; 214..274; SH3; 281..377; SH2; 402..655; Protein kinase

Region

12..24; Inositol-(1,3,4,5)-tetrakisphosphate 1-binding; 171..210; Disordered

Protein Families

Protein kinase superfamily
Tyr protein kinase family
TEC subfamily

Sequence Similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.

Clinical Relevance

Disease Involvement

Cancer-related genesDisease variantDwarfismFDA approved drug targets

Related Diseases

COVID-19 Leukaemia

Biomarker

Phase 2; Approved

Drug Targets

FDA approved drug targets

Antibody

HPA001198 HPA002028 CAB016689 CAB080300

Interaction Protein

ENSG00000005700ENSG00000095585ENSG00000100124ENSG00000131370ENSG00000177885ENSG00000263001

Interaction Count

6

Interaction Dataset

intact_biogridbiogrid_bioplex

Protein symbol BTK	UniProt ID Q06187	EVMP score 0.63
Frequency 9	Transmembrane count	Protein classification Cancer-related genesDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteins