Protein detail
BTK
Tyrosine-protein kinase BTK (EC 2.7.10.2) (Agammaglobulinemia tyrosine kinase) (ATK) (B-cell progenitor kinase) (BPK) (Bruton tyrosine kinase)
Entry name BTK | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 9 | Transmembrane count | Protein classification Cancer-related genesDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Tyrosine-protein kinase BTK (EC 2.7.10.2) (Agammaglobulinemia tyrosine kinase) (ATK) (B-cell progenitor kinase) (BPK) (Bruton tyrosine kinase)
Protein Class (7)
Cancer-related genesDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (9)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Enzymes
- Cancer-related genes
- Kinases:Tyr protein kinases
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
AGMX1ATKIMD1PSCTK1XLA
Gene Description
Bruton tyrosine kinase
Chromosome
X
Position
101349338-101390796
Supporting publications (n)
9
EVMP confidence score
0.50
Fluorescence & Localization
Tissue SpecificbrainCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificcommitted oligodendrocyte precursor
Function & Pathway
Protein Function (9)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Enzymes
- Cancer-related genes
- Kinases:Tyr protein kinases
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Cellular Component (7)
Molecular Function (9)
- GO:0004713 protein tyrosine kinase activity
- GO:0004715 non-membrane spanning protein tyrosine kinase activity
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
- GO:0016004 phospholipase activator activity
- GO:0042802 identical protein binding
- GO:0043274 phospholipase binding
- GO:0046872 metal ion binding
Biological Process (3)
KEGG (7)
Reactome (28)
- R-hsa-1280218 adaptive immune system
- R-hsa-983695 antigen activates b cell receptor bcr leading to generation of second messengers
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-5260271 diseases of immune system
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-2454202 fc epsilon receptor fceri signaling
Page 1 of 3
Canonical Pathways (3)
- M83 Pid cdc42 reg pathway
- M241 Pid rac1 reg pathway
- M68 Pid rhoa reg pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence73
Enzyme-Mediated Modification (23)
23 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| BTK | TLR9 | Q9NR96 | Y | 551 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:26478008 |
| BTK | CSK | P41240 | Y | 551 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:10196129 |
| BTK | PRKCA | P17252 | S | 179 | phosphorylation | KEA | KEA:11598012 |
Page 3 of 3Previous
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Page 2 of 2Previous
Regulatory Interaction Network (30)
30 records.
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_SC_Cluster107 | IBTKRANRANGRFRCC1 | P18754P62826Q9HD47Q9P2D0 | 1:1:1:1 | Compleat | Compleat:HC2468 | |
| CSE1LIBTKKPNA4KPNB1NUP153NUTF2RANRANBP1RANBP3RCC1SNRPNUBCXPO1 | O00629O14980P0CG48P18754P43487P49790P55060P61970P62826P63162Q14974Q9H6Z4Q9P2D0 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9631 | ||
| IBTKPOP7RPP25L | O75817Q8N5L8Q9P2D0 | 0:0:0 | hu.MAP | |||
| BTK | Q06187 | 2 | PDB | PDB:1k2pPDB:6yyfPDB:6yykPDB:6nzmPDB:6yygPDB:5zz4PDB:6tfpPDB:4nwmPDB:5bpyPDB:7l5pPDB:6tt2PDB:6x3oPDB:1btkPDB:8yvvPDB:1bwnPDB:6tsePDB:5fbnPDB:2z0pPDB:3p08PDB:4yhfPDB:6s90PDB:5jrsPDB:6tvnPDB:5xyzPDB:1b55PDB:6tuhPDB:5j87 | ||
| BIRC2BTK | Q06187Q13490 | 2:2 | PDB | PDB:6w8iPDB:8dsoPDB:6w7o | ||
| ANKRD54BTK | Q06187Q6NXT1 | 0:0 | hu.MAP2 | |||
| IBTKRPP25L | Q8N5L8Q9P2D0 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass Spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
659
Mass
76,281
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Alternative Products
Event=Alternative promoter usage; Named isoforms=2; Name=BTK-A; IsoId=Q06187-1; Sequence=Displayed; Name=BTK-C; IsoId=Q06187-2; Sequence=VSP_053838
Alternative Sequence
1; M -> MASWSIQQMVIGCPLCGRHCSGGEHTGELQKEEAM (in isoform BTK-C)
3D Structural Models
Turn
44..47; 153..155; 212..215; 257..259; 266..268; 340..342; 422..424; 434..436; 524..526; 592..594; 597..600
Helix
58..60; 75..77; 93..96; 118..132; 288..298; 355..362; 393..395; 399..401; 439..450; 482..487; 489..491; 495..514; 542..545; 549..551; 561..563; 566..571; 576..591; 603..611; 624..632; 638..640; 644..657
Beta Strand
5..13; 15..17; 19..21; 25..32; 34..43; 48..57; 63..66; 82..85; 100..106; 109..117; 140..142; 149..152; 165..167; 218..223; 228..232; 240..242; 248..252; 261..265; 279..282; 303..308; 310..313; 315..321; 330..335; 337..339; 344..347; 352..354; 369..371; 373..376; 402..410; 412..414; 415..421; 425..431; 460..464; 466..469; 471..474; 527..529; 535..537; 556..559
3D Structure
NMR spectroscopy (4); X-ray crystallography (129)
Domain & Motif Annotations
Motif
581..588; CAV1-binding
Zinc Finger
135..171; Btk-type
Domain (CC)
The PH domain mediates the binding to inositol polyphosphate and phosphoinositides, leading to its targeting to the plasma membrane. It is extended in the BTK kinase family by a region designated the TH (Tec homology) domain, which consists of about 80 residues preceding the SH3 domain.
Domain (FT)
3..133; PH; 214..274; SH3; 281..377; SH2; 402..655; Protein kinase
Region
12..24; Inositol-(1,3,4,5)-tetrakisphosphate 1-binding; 171..210; Disordered
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- TEC subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
Clinical Relevance
Disease Involvement (4)
Cancer-related genesDisease variantDwarfismFDA approved drug targets
Biomarker
Phase 2; Approved
Drug Targets
FDA approved drug targets
Drugs (52)
IBRUTINIBEDRALBRUTINIBNULLBRANEBRUTINIBZANUBRUTINIBCENISERTIBACALABRUTINIBPF-06651600HG2+VANDETANIBVECABRUTINIBRILZABRUTINIBPIRTOBRUTINIBALISERTIBBARASERTIB-HQPAFENEBRUTINIBSPEBRUTINIBZM447439POSELTINIBELSUBRUTINIBABIVERTINIBPD-0166285DOVITINIBMSC-2364447BTK INHIBITOR DTRMWXHS-12EVOBRUTINIBBMS-986142TIRABRUTINIBPP2MLN-8054SPEBRUTINIB BESYLATENVP-TAE684NEMTABRUTINIBTOLEBRUTINIBENTRECTINIBILORASERTIBDASATINIB ANHYDROUSBTK INHIBITORRG-1530TAK-020ABIVERTINIB MALEATEBIIB068TAMATINIBHESPERADINBTK INHIBITOR TL-895ORELABRUTINIBACALABRUTINIB MALEATECHEMBL:CHEMBL1997335PI3K-DELTA INHIBITOR AMG 319PF-562271TOZASERTIBREMIBRUTINIB
Interaction Protein (6)
ENSG00000005700ENSG00000095585ENSG00000100124ENSG00000131370ENSG00000177885ENSG00000263001
Interaction Count
6
Interaction Dataset (2)
intact_biogridbiogrid_bioplex
Supporting Publications9
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 28396511 | Database-augmented Mass Spectrometry Analysis of Exosomes Identifies Claudin 3 as a Putative Prostate Cancer Biomarker. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 31941606 | The role of actinin-4 (ACTN4) in exosomes as a potential novel therapeutic target in castration-resistant prostate cancer. | No related sentences available |
| 36612172 | Extracellular Vesicle Membrane Protein Profiling and Targeted Mass Spectrometry Unveil CD59 and Tetraspanin 9 as Novel Plasma Biomarkers for Detection of Colorectal Cancer. | No related sentences available |
| 37205098 | Proteomic profiling of extracellular vesicles in synovial fluid and plasma from Oligoarticular Juvenile Idiopathic Arthritis patients reveals novel immunopathogenic biomarkers. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39558134 | Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis. | No related sentences available |