Protein detail
APLP2
Amyloid beta precursor like protein 2 (APPH) (Amyloid beta (A4) precursor-like protein 2) (Amyloid protein homolog) (Amyloid-like protein 2) (APLP-2) (CDEI box-binding protein) (CDEBP) (Sperm membrane protein YWK-II)
Entry name APLP2 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 21 | Transmembrane count 1 | Protein classification Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Amyloid beta precursor like protein 2 (APPH) (Amyloid beta (A4) precursor-like protein 2) (Amyloid protein homolog) (Amyloid-like protein 2) (APLP-2) (CDEI box-binding protein) (CDEBP) (Sperm membrane protein YWK-II)
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
693..716; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
APPHAPPL2
Gene Description
Amyloid beta precursor like protein 2
Chromosome
11
Position
130068147-130144811
Supporting publications (n)
21
EVMP confidence score
0.88
Fluorescence & Localization
Brain Regional Specificchoroid plexusCell SpecificPlateletsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (6)
Biological Process (3)
Reactome (5)
- R-hsa-109582 hemostasis
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-597592 post translational protein modification
- R-hsa-381426 regulation of insulin like growth factor igf transport and uptake by insulin like growth factor binding proteins igfbps
- R-hsa-76005 response to elevated platelet cytosolic ca2
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence59
Enzyme-Mediated Modification (11)
11 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| APLP2 | CSNK2A2 | P19784 | T | 736 | phosphorylation | KEA | KEA:17570479 |
Page 2 of 2Previous
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_sosui | transmembrane_predicted | Almen2009 | Yes | ||||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | Yes |
Page 5 of 5Previous
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | APLP2 | Q06481 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | ProtMapper:9109675PhosphoSite:9109675iPTMnet:9109675HPRD-phos:9109675HPRD:9109675SIGNOR:9109675KEA:9109675 | ||
| CDK1 | P06493 | APLP2 | Q06481 | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAHPRDWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetELMKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperHPRD-phos | ELM:9109675KEA:14970211ProtMapper:9109675iPTMnet:9109675HPRD-phos:9109675HPRD:9109675SIGNOR:9109675KEA:9109675phosphoELM:9109675 | |
| MK08 | P45983 | APLP2 | Q06481 | Yes | Yes | BEL-Large-Corpus_ProtMapperPhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | KEA:14970211ProtMapper:15212693phosphoELM:14970211SIGNOR:14970211KEA:9109675ProtMapper:14970211 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 31414377 |
Sequence, Structure & Domains
Sequences
Length
763
Mass
86,956
Sequence
MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVCKAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMKKGSGVGEQDGGLIGAEEKVINSKNKVDENMVIDETLDVKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLVIAVAIATVIVISLVMLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI
Alternative Products
Event=Alternative splicing; Named isoforms=6; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q06481-1; Sequence=Displayed; Name=2; IsoId=Q06481-2; Sequence=VSP_000018; Name=3; IsoId=Q06481-3; Sequence=VSP_000019; Name=4; IsoId=Q06481-4; Sequence=VSP_000018, VSP_046882, VSP_000019; Name=5; IsoId=Q06481-5; Sequence=VSP_030921, VSP_000019; Name=6; IsoId=Q06481-6; Sequence=VSP_046881, VSP_000019
Alternative Sequence
1..35; MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIE -> MLRAPGELPRQAARCSLCRLGPGRGRAFFKWRCLPASVDRGNPLW (in isoform 6); 136..364; Missing (in isoform 5); 308..363; Missing (in isoform 2 and isoform 4); 364; I -> V (in isoform 4); 613..624; Missing (in isoform 3, isoform 4, isoform 5 and isoform 6)
3D Structural Models
Turn
330..333; 418..421
Helix
345..347; 353..359; 374..377; 386..417; 424..480; 486..517; 519..545; 546..549; 551..556; 558..566
Beta Strand
325..329; 334..338; 481..483
3D Structure
NMR spectroscopy (1); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
215..233; Acidic residues; 242..269; Acidic residues; 270..282; Basic and acidic residues
Motif
750..755; NPXY motif
Domain (FT)
46..205; E1; 306..364; BPTI/Kunitz inhibitor; 373..564; E2
Region
46..139; GFLD subdomain; 147..205; CuBD subdomain; 211..299; Disordered; 749..763; Interaction with DAB2
Protein Families
APP family
Sequence Similarities
Belongs to the APP family.
Clinical Relevance
Drugs (20)
Antibody
Interaction Protein (3)
ENSG00000113108ENSG00000166313ENSG00000177606
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications21
| PMID | Title | Related sentences |
|---|---|---|
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 37670049 | Proteomic and functional characterisation of extracellular vesicles from collagen VI deficient human fibroblasts reveals a role in cell motility. | No related sentences available |
| 37926756 | Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 38607062 | Enrichment, Characterization, and Proteomic Profiling of Small Extracellular Vesicles Derived from Human Limbal Mesenchymal Stromal Cells and Melanocytes. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40465195 | Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome. | No related sentences available |
| 40940449 | Extracellular vesicle-associated transcriptomic and proteomic biomarkers show in vitro potential for vandetanib treatment monitoring in anaplastic thyroid cancer. | No related sentences available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No related sentences available |