Protein detail
C1QBP
Complement component 1 Q subcomponent-binding protein, mitochondrial (ASF/SF2-associated protein p32) (Glycoprotein gC1qBP) (C1qBP) (Hyaluronan-binding protein 1) (Mitochondrial matrix protein p32) (gC1q-R protein) (p33) (SF2AP32)
Entry name C1QBP | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Complement component 1 Q subcomponent-binding protein, mitochondrial (ASF/SF2-associated protein p32) (Glycoprotein gC1qBP) (C1qBP) (Hyaluronan-binding protein 1) (Mitochondrial matrix protein p32) (gC1q-R protein) (p33) (SF2AP32)
Protein Class (8)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters
Protein Function (7)
- Transporters
- Human disease related genes:Congenital disorders of metabolism:Mitochondrial diseases
- Predicted intracellular proteins
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
gC1Q-RgC1qRHABP1p32SF2p32
Gene Description
Complement C1q binding protein
Chromosome
17
Position
5432777-5448830
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificheart muscleCell SpecificBreast myoepithelial cellsSingle-Nuclei Brain SpecificastrocyteSecretome LocationIntracellular and membraneSecretome FunctionOther
Function & Pathway
Protein Function (7)
- Transporters
- Human disease related genes:Congenital disorders of metabolism:Mitochondrial diseases
- Predicted intracellular proteins
- Potential drug targets
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Disease related genes
Cellular Component (10)
Molecular Function (11)
- GO:0001849 complement component C1q complex binding
- GO:0003714 transcription corepressor activity
- GO:0003729 mRNA binding
- GO:0004857 enzyme inhibitor activity
- GO:0005515 protein binding
- GO:0005540 hyaluronic acid binding
- GO:0008134 transcription factor binding
- GO:0030984 kininogen binding
- GO:0031690 adrenergic receptor binding
- GO:0060703 deoxyribonuclease inhibitor activity
Page 1 of 2
Biological Process (3)
Reactome (13)
- R-hsa-109581 apoptosis
- R-hsa-111471 apoptotic factor mediated response
- R-hsa-9734009 defective intrinsic pathway for apoptosis
- R-hsa-9645723 diseases of programmed cell death
- R-hsa-140877 formation of fibrin clot clotting cascade
- R-hsa-109582 hemostasis
- R-hsa-109606 intrinsic pathway for apoptosis
- R-hsa-140837 intrinsic pathway of fibrin clot formation
- R-hsa-5357801 programmed cell death
- R-hsa-8980692 rhoa gtpase cycle
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationImmune mediationReceptor-signaling mediation
Relations & Evidence39
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| C1QBP | MMP14 | P50281 | G | 152 | cleavage | HPRD | HPRD:11773076 |
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes | ||||
| secreted | secreted | OmniPath | Yes |
Page 2 of 2Previous
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| C1QBP | Q07021 | COMPLEX:P02745_P02746_P02747 | Yes | Yes | SIGNOR | SIGNOR:28018340 | ||
| C1QBP | Q07021 | C1QB | P02746 | Yes | Yes | SIGNOR | SIGNOR:28018340 | |
| C1QBP | Q07021 | C1QA | P02745 | Yes | Yes | HPRDSIGNORIntAct | IntAct:34804054SIGNOR:28018340HPRD:8195709IntAct:28018340 | |
| C1QBP | Q07021 | C1QC | P02747 | Yes | Yes | SIGNOR | SIGNOR:28018340 | |
| C1QBP | Q07021 | K2C1 | P04264 | Yes | Yes | SIGNOR | SIGNOR:14691569 |
Protein Complex Composition (19)
19 records.
Page 1 of 2Next
Sequence, Structure & Domains
Sequences
Length
282
Mass
31,362
Sequence
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
3D Structural Models
Turn
106..108
Helix
77..95; 175..177; 228..230; 233..245; 250..280
Beta Strand
110..114; 117..123; 125..134; 167..174; 180..187; 199..201; 206..213; 225..227
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Region
76..93; C1q binding; 138..164; Disordered; 168..213; Interaction with MAVS
Protein Families
MAM33 family
Sequence Similarities
Belongs to the MAM33 family.
Clinical Relevance
Disease Involvement (3)
Cancer-related genesDisease variantPrimary mitochondrial disease
Related Diseases
Drugs (16)
Antibody
Interaction Protein (13)
ENSG00000065978ENSG00000067606ENSG00000106153ENSG00000107625ENSG00000122859ENSG00000129245ENSG00000140988ENSG00000143815ENSG00000146963ENSG00000165732ENSG00000184304ENSG00000257103ENSG00000260596
Interaction Count
13
Interaction Dataset (5)
intact_biogridbiogrid_bioplexintact_biogrid_bioplexintact_biogrid_opencellbiogrid_opencell
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No related sentences available |