Protein detail
ACK1
Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2)
Protein symbol ACK1 | UniProt ID | EVMP score 0.50 |
Frequency 2 | Transmembrane count | Protein classification Cancer-related genesEnzymesPlasma proteinsPredicted intracellular proteins |
Basic Information
Protein Names
Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2)
Protein Class
Cancer-related genesEnzymesPlasma proteinsPredicted intracellular proteins
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:Tyr protein kinases
Ensembl
Entrez Gene Symbol
Gene Synonym
ACKACK1p21cdc42Hs
Gene Description
Tyrosine kinase non receptor 2
Chromosome
3
Position
195863364-195911945
Frequency
2
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificAdipocytes
Function & Pathway
Protein Function
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:Tyr protein kinases
Cellular Component
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005768 endosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005905 clathrin-coated pit
- GO:0005912 adherens junction
- GO:0016020 membrane
- GO:0030136 clathrin-coated vesicle
- GO:0030659 cytoplasmic vesicle membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0048471 perinuclear region of cytoplasm
- GO:0070436 Grb2-EGFR complex
- GO:0097268 cytoophidium
Molecular Function
- GO:0004712 protein serine/threonine/tyrosine kinase activity
- GO:0004713 protein tyrosine kinase activity
- GO:0004715 non-membrane spanning protein tyrosine kinase activity
- GO:0005095 GTPase inhibitor activity
- GO:0005154 epidermal growth factor receptor binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0031625 ubiquitin protein ligase binding
- GO:0042802 identical protein binding
- GO:0044024 histone H2AS1 kinase activity
- GO:0046872 metal ion binding
- GO:0050699 WW domain binding
- GO:0106310 protein serine kinase activity
Biological Process
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TNK2 | CDC42 | P60953 | Y | 284 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:21637378 |
| TNK2 | CSNK1A1 | P48729 | Y | 284 | phosphorylation | KEA | KEA:14506255 |
Page 2 of 2Previous
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network
10 records.
Protein Complex Composition
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| BTBD3CRTC2FAM83AFAM83HOCRLPKP2PKP3SEC24BSEC24CTNK2USO1 | O60763O95487P53992Q01968Q07912Q53ET0Q6ZRV2Q86UY5Q99959Q9Y2F9Q9Y446 | 0:0:0:0:0:0:0:0:0:0:0 | hu.MAP | |||
| BTBD3CRTC2FAM83AGLDCPKP2SEC23BSEC24CSEC24DTNK2 | O94855P23378P53992Q07912Q15437Q53ET0Q86UY5Q99959Q9Y2F9 | 0:0:0:0:0:0:0:0:0 | hu.MAP | |||
| CDC42TNK2 | P60953Q07912 | 1:1 | PDB | PDB:1cf4 | ||
| TNK2 | Q07912 | 2 | PDB | PDB:3eqpPDB:4hzsPDB:7kp6PDB:1u46PDB:3eqrPDB:5zxbPDB:1u4dPDB:6vqmPDB:4ewhPDB:8hmtPDB:1u54PDB:8fz3PDB:4hzr | ||
| SETD2TNK2 | Q07912Q9BYW2 | 1:1 | PDB | PDB:8q5p |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
1,038
Mass
114,569
Sequence
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q07912-1; Sequence=Displayed; Name=2; IsoId=Q07912-2; Sequence=VSP_008655, VSP_008656; Name=3; IsoId=Q07912-3; Sequence=VSP_037284, VSP_037285, VSP_037286
Alternative Sequence
1; M -> MGERSAYQRLAGGEEGPQRLGGGRM (in isoform 3); 485..528; LYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPL -> CPFSAFSPGHPPAETCGQVLWTGRREACASDPRLHPVSSRTKGL (in isoform 2); 514; K -> KREPPPRPPQPAFFTQ (in isoform 3); 529..1038; Missing (in isoform 2); 965..994; Missing (in isoform 3)
3D Structural Models
Turn
164..166; 325..327; 330..333; 484..486
Helix
123..125; 171..181; 213..219; 221..223; 226..245; 255..257; 273..276; 288..290; 294..296; 299..304; 309..324; 336..344; 358..367; 372..374; 378..387; 440..443
Beta Strand
118..120; 126..133; 140..146; 148..150; 152..159; 192..196; 198..200; 202..206; 209..212; 258..262; 265..268; 283..285; 306..308; 392..394; 402..404; 412..417; 419..421; 423..432; 435..439; 449..451
3D Structure
NMR spectroscopy (1); X-ray crystallography (17)
Domain & Motif Annotations
Compositional Bias
738..749; Pro residues; 772..783; Pro residues; 794..805; Pro residues
Domain (CC)
The EBD (EGFR-binding domain) domain is necessary for interaction with EGFR.; DOMAIN: The SAM-like domain is necessary for NEDD4-mediated ubiquitination. Promotes membrane localization and dimerization to allow for autophosphorylation.; DOMAIN: The UBA domain binds both poly- and mono-ubiquitin.
Domain (FT)
126..385; Protein kinase; 388..448; SH3; 454..466; CRIB; 958..996; UBA
Region
1..110; SAM-like domain; 90..114; Disordered; 497..535; Disordered; 623..652; Required for interaction with SRC; 632..635; Required for interaction with NEDD4; 659..702; Disordered; 718..840; Disordered; 733..876; EBD domain; 917..957; Disordered
Protein Families
- Protein kinase superfamily
- Tyr protein kinase family
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Drug Targets
Patented-recorded target
Drugs
Interaction Protein
ENSG00000050820ENSG00000071051ENSG00000096384ENSG00000130340ENSG00000141367ENSG00000158092ENSG00000177885
Interaction Count
7
Interaction Dataset
intact_biogridbiogrid_bioplex