Protein detail
ACK1
Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2)
Entry name ACK1 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Cancer-related genesEnzymesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2)
Protein Class (4)
Cancer-related genesEnzymesPlasma proteinsPredicted intracellular proteins
Protein Function (5)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:Tyr protein kinases
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ACKACK1p21cdc42Hs
Gene Description
Tyrosine kinase non receptor 2
Chromosome
3
Position
195863364-195911945
Supporting publications (n)
2
EVMP confidence score
0.28
Fluorescence & Localization
Cell SpecificAdipocytes
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Kinases:Tyr protein kinases
Cellular Component (14)
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005768 endosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005905 clathrin-coated pit
- GO:0005912 adherens junction
- GO:0016020 membrane
- GO:0030136 clathrin-coated vesicle
- GO:0030659 cytoplasmic vesicle membrane
Page 1 of 2
Molecular Function (13)
- GO:0004712 protein serine/threonine/tyrosine kinase activity
- GO:0004713 protein tyrosine kinase activity
- GO:0004715 non-membrane spanning protein tyrosine kinase activity
- GO:0005095 GTPase inhibitor activity
- GO:0005154 epidermal growth factor receptor binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0031625 ubiquitin protein ligase binding
- GO:0042802 identical protein binding
- GO:0044024 histone H2AS1 kinase activity
Page 1 of 2
Biological Process (3)
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence37
Enzyme-Mediated Modification (12)
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TNK2 | CDC42 | P60953 | Y | 284 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:21637378 |
| TNK2 | CSNK1A1 | P48729 | Y | 284 | phosphorylation | KEA | KEA:14506255 |
Page 2 of 2Previous
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Regulatory Interaction Network (10)
10 records.
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| BTBD3CRTC2FAM83AFAM83HOCRLPKP2PKP3SEC24BSEC24CTNK2USO1 | O60763O95487P53992Q01968Q07912Q53ET0Q6ZRV2Q86UY5Q99959Q9Y2F9Q9Y446 | 0:0:0:0:0:0:0:0:0:0:0 | hu.MAP | |||
| BTBD3CRTC2FAM83AGLDCPKP2SEC23BSEC24CSEC24DTNK2 | O94855P23378P53992Q07912Q15437Q53ET0Q86UY5Q99959Q9Y2F9 | 0:0:0:0:0:0:0:0:0 | hu.MAP | |||
| CDC42TNK2 | P60953Q07912 | 1:1 | PDB | PDB:1cf4 | ||
| TNK2 | Q07912 | 2 | PDB | PDB:3eqpPDB:4hzsPDB:7kp6PDB:1u46PDB:3eqrPDB:5zxbPDB:1u4dPDB:6vqmPDB:4ewhPDB:8hmtPDB:1u54PDB:8fz3PDB:4hzr | ||
| SETD2TNK2 | Q07912Q9BYW2 | 1:1 | PDB | PDB:8q5p |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
1,038
Mass
114,569
Sequence
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q07912-1; Sequence=Displayed; Name=2; IsoId=Q07912-2; Sequence=VSP_008655, VSP_008656; Name=3; IsoId=Q07912-3; Sequence=VSP_037284, VSP_037285, VSP_037286
Alternative Sequence
1; M -> MGERSAYQRLAGGEEGPQRLGGGRM (in isoform 3); 485..528; LYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPL -> CPFSAFSPGHPPAETCGQVLWTGRREACASDPRLHPVSSRTKGL (in isoform 2); 514; K -> KREPPPRPPQPAFFTQ (in isoform 3); 529..1038; Missing (in isoform 2); 965..994; Missing (in isoform 3)
3D Structural Models
Turn
164..166; 325..327; 330..333; 484..486
Helix
123..125; 171..181; 213..219; 221..223; 226..245; 255..257; 273..276; 288..290; 294..296; 299..304; 309..324; 336..344; 358..367; 372..374; 378..387; 440..443
Beta Strand
118..120; 126..133; 140..146; 148..150; 152..159; 192..196; 198..200; 202..206; 209..212; 258..262; 265..268; 283..285; 306..308; 392..394; 402..404; 412..417; 419..421; 423..432; 435..439; 449..451
3D Structure
NMR spectroscopy (1); X-ray crystallography (17)
Domain & Motif Annotations
Compositional Bias
738..749; Pro residues; 772..783; Pro residues; 794..805; Pro residues
Domain (CC)
The EBD (EGFR-binding domain) domain is necessary for interaction with EGFR.; DOMAIN: The SAM-like domain is necessary for NEDD4-mediated ubiquitination. Promotes membrane localization and dimerization to allow for autophosphorylation.; DOMAIN: The UBA domain binds both poly- and mono-ubiquitin.
Domain (FT)
126..385; Protein kinase; 388..448; SH3; 454..466; CRIB; 958..996; UBA
Region
1..110; SAM-like domain; 90..114; Disordered; 497..535; Disordered; 623..652; Required for interaction with SRC; 632..635; Required for interaction with NEDD4; 659..702; Disordered; 718..840; Disordered; 733..876; EBD domain; 917..957; Disordered
Protein Families (2)
- Protein kinase superfamily
- Tyr protein kinase family
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Drug Targets
Patented-recorded target
Drugs (19)
Interaction Protein (7)
ENSG00000050820ENSG00000071051ENSG00000096384ENSG00000130340ENSG00000141367ENSG00000158092ENSG00000177885
Interaction Count
7
Interaction Dataset (2)
intact_biogridbiogrid_bioplex
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |
| 40689422 | Defining the Ovarian Cancer Precancerous Landscape through Modeling Fallopian Tube Epithelium Reprogramming Driven by Extracellular Vesicles. | No related sentences available |