Protein detail

SPIR1

Protein spire homolog 1 (Spir-1)

Entry name SPIR1	UniProt ID Q08AE8	EVMP confidence score 0.38
Supporting publications (n) 4	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein spire homolog 1 (Spir-1)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000134278

Entrez Gene Symbol

SPIRE1

Gene Synonym (2)

KIAA1135spir-1

Gene Description

Spire type actin nucleation factor 1

Chromosome

Position

12446512-12658107

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Cell SpecificChoroid plexus epithelial cellsBlood Cell Specificneutrophil

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (8)

Molecular Function (3)

Biological Process (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence11

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Protein Complex Composition (3)

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
BCL7A POTEJ SPIRE1	P0CG39 Q08AE8 Q4VC05	0:0:0	hu.MAP2
BCL7A MRTFA POTEJ SPIRE1 SPIRE2	P0CG39 Q08AE8 Q4VC05 Q8WWL2 Q969V6	0:0:0:0:0	hu.MAP2
SPIRE1	Q08AE8	4	PDB	PDB:3rbw

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass Spectrometry	1	32384937

Sequence, Structure & Domains16

Sequences

Length

756

Mass

85,544

Sequence

MAQAAGPAGGGEPRTEAVGGEGPREPGAAGGAAGGSRDALSLEEILRLYNQPINEEQAWAVCYQCCGSLRAAARRRQPRHRVRSAAQIRVWRDGAVTLAPAADDAGEPPPVAGKLGYSQCMETEVIESLGIIIYKALDYGLKENEERELSPPLEQLIDHMANTVEADGSNDEGYEAAEEGLGDEDEKRKISAIRSYRDVMKLCAAHLPTESDAPNHYQAVCRALFAETMELHTFLTKIKSAKENLKKIQEMEKSDESSTDLEELKNADWARFWVQVMRDLRNGVKLKKVQERQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVMVNGDIPPRLKKSAHEIILDFIRSRPPLNPVSARKLKPTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLAMRPLSMSYSFDLSDVTTPESTKNLVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHKSTSSSSVSPSFPEEPVLEAVSTRKKPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRSLEEFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYKDIYTALKKGKLCFCCRTRRFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q08AE8-1; Sequence=Displayed; Name=5; IsoId=Q08AE8-5; Sequence=VSP_054464, VSP_052595; Name=2; IsoId=Q08AE8-2; Sequence=VSP_052595; Name=3; IsoId=Q08AE8-3; Sequence=VSP_037925, VSP_052595; Name=4; IsoId=Q08AE8-4; Sequence=VSP_037925, VSP_052595, VSP_037926

Alternative Sequence

1..159; Missing (in isoform 3 and isoform 4); 1..120; Missing (in isoform 5); 397..410; Missing (in isoform 2, isoform 3, isoform 4 and isoform 5); 616..756; RPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI -> SDCLFNGTAHCQFYLG (in isoform 4)

3D Structural Models

Turn

138..140

Helix

42..49; 55..74; 85..87; 122..137; 151..160; 196..204; 210..212; 213..234

Beta Strand

38..41; 88..91; 96..98; 116..120; 145..147; 207..209

3D Structure

X-ray crystallography (4)

Domain & Motif Annotations

Compositional Bias

425..447; Polar residues; 474..492; Low complexity; 512..528; Basic and acidic residues; 529..538; Polar residues

Coiled Coil

229..257

Domain (CC)

Binds to actin monomers via the WH2 domain.; DOMAIN: The Spir-box targets binding to intracellular membrane structures.

Domain (FT)

40..231; KIND; 305..323; WH2 1; 369..386; WH2 2

Region

1..35; Disordered; 131..138; Important for interaction with FMN2; 425..538; Disordered; 556..576; Spir-box

Protein Families

Spire family

Sequence Similarities

Belongs to the spire family.

Clinical Relevance4

Antibody (2)

HPA040737 HPA040942

Interaction Protein (3)

ENSG00000075624ENSG00000134308ENSG00000164924

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid

Supporting Publications4

PMID	Title	Abstract
29148239	Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants.	No abstract available
32089743	Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism.	No abstract available
36398564	Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles.	No abstract available
37786918	Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples.	No abstract available