Protein detail
BST1
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 (EC 3.2.2.6) (ADP-ribosyl cyclase 2) (Bone marrow stromal cell antigen 1) (BST-1) (Cyclic ADP-ribose hydrolase 2) (cADPR hydrolase 2) (CD antigen CD157)
Entry name BST1 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count | Protein classification CD markersEnzymesFDA approved drug targetsMetabolic proteinsPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 (EC 3.2.2.6) (ADP-ribosyl cyclase 2) (Bone marrow stromal cell antigen 1) (BST-1) (Cyclic ADP-ribose hydrolase 2) (cADPR hydrolase 2) (CD antigen CD157)
Protein Class (6)
CD markersEnzymesFDA approved drug targetsMetabolic proteinsPlasma proteinsPredicted intracellular proteins
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Enzymes
- ENZYME proteins:Hydrolases
- FDA approved drug targets:Small molecule drugs
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
BST-1cADPR2CD157
Gene Description
Bone marrow stromal cell antigen 1
Chromosome
4
Position
15703065-15738313
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization3
Tissue Specificlymphoid tissueCell SpecificEarly primary spermatocytesSingle-Nuclei Brain Specificendothelial cell
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Enzymes
- ENZYME proteins:Hydrolases
- FDA approved drug targets:Small molecule drugs
Cellular Component (6)
Molecular Function (4)
Biological Process (3)
KEGG (4)
Reactome (7)
- R-hsa-168249 innate immune system
- R-hsa-196854 metabolism of vitamins and cofactors
- R-hsa-196849 metabolism of water soluble vitamins and cofactors
- R-hsa-6798695 neutrophil degranulation
- R-hsa-196807 nicotinate metabolism
- R-hsa-163125 post translational modification synthesis of gpi anchored proteins
- R-hsa-597592 post translational protein modification
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence15
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_peripheral | plasma_membrane_peripheral | OmniPath | No | No | No | No | Yes |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | Yes |
| cell_surface | cell_surface | OmniPath | No | No | No | No | Yes |
Page 2 of 2Previous
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass Spectrometry | 1 | 32384937 |
Sequence, Structure & Domains11
Sequences
Length
318
Mass
35,724
Sequence
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q10588-1; Sequence=Displayed; Name=2; IsoId=Q10588-2; Sequence=VSP_055507
Alternative Sequence
6..63; Missing (in isoform 2)
3D Structural Models
Turn
121..124; 137..140; 160..162
Helix
43..57; 60..62; 67..74; 75..78; 87..90; 91..97; 113..120; 129..131; 133..136; 167..181; 205..209; 211..213; 216..218; 242..252; 264..271; 278..280
Beta Strand
106..111; 147..152; 154..157; 185..192; 202..204; 219..227; 257..261
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Protein Families
ADP-ribosyl cyclase family
Sequence Similarities
Belongs to the ADP-ribosyl cyclase family.
Clinical Relevance4
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No abstract available |