Protein detail
PTPRJ
Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)
Entry name PTPRJ | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersEnzymesPlasma proteinsPredicted membrane proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)
Protein Class (5)
CD markersEnzymesPlasma proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function (4)
- Enzymes
- Predicted secreted proteins
- CD markers
- ENZYME proteins:Hydrolases
Transmembrane
976..996; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
CD148DEP1HPTPeta
Gene Description
Protein tyrosine phosphatase receptor type J
Chromosome
11
Position
47980425-48170839
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificlungCell SpecificKupffer cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificintermediate monocyteBlood Lineage SpecificmonocytesSecretome LocationSecreted to bloodSecretome FunctionReceptor
Function & Pathway
Protein Function (4)
- Enzymes
- Predicted secreted proteins
- CD markers
- ENZYME proteins:Hydrolases
Cellular Component (7)
Molecular Function (10)
- GO:0004725 protein tyrosine phosphatase activity
- GO:0005161 platelet-derived growth factor receptor binding
- GO:0005515 protein binding
- GO:0008013 beta-catenin binding
- GO:0016791 phosphatase activity
- GO:0019901 protein kinase binding
- GO:0045295 gamma-catenin binding
- GO:0045296 cadherin binding
- GO:0051019 mitogen-activated protein kinase binding
- GO:0070097 delta-catenin binding
Biological Process (3)
Reactome (11)
- R-hsa-1280218 adaptive immune system
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-9607240 flt3 signaling
- R-hsa-168249 innate immune system
- R-hsa-9706369 negative regulation of flt3
- R-hsa-6807004 negative regulation of met activity
- R-hsa-6798695 neutrophil degranulation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-6806834 signaling by met
- R-hsa-9006934 signaling by receptor tyrosine kinases
Page 1 of 2
Mediation Categories (5)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence70
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PTPRJ | SRC | P12931 | Y | 1,320 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:26556953 |
| PTPRJ | SRC | P12931 | Y | 1,311 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:26556953 |
| PTPRJ | FYN | P06241 | Y | 1,320 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:26556953 |
| PTPRJ | FYN | P06241 | Y | 1,311 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:26556953 |
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | HPMR | Yes | Yes | |||
| extracellular | extracellular | OmniPath | Yes | Yes | |||
| intracellular | intracellular | LOCATE | Yes | Yes | |||
| intracellular | intracellular | GO_Intercell | Yes | Yes | |||
| intracellular | intracellular | OmniPath | Yes | Yes | |||
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | Yes | Yes | |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | Yes | Yes | |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| transmembrane | transmembrane | UniProt_location | Yes | Yes |
Regulatory Interaction Network (22)
22 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PTPRJ | Q12913 | PGFRB | P09619 | Yes | Yes | WangNCI-PID_ProtMapperSIGNORProtMapperDEPODHPRDHINTKEAKinexus_KEAIntActSIGNOR_ProtMapperHPRD-phos | KEA:7876130IntAct:10821867IntAct:19167335HPRD-phos:12062403ProtMapper:12062403SIGNOR:12062403KEA:10821867ProtMapper:10821867KEA:14966296KEA:1691440HPRD:12062403DEPOD:12062403DEPOD:10821867HINT:10821867KEA:10391677KEA:8940081 | |
| CSK21 | P68400 | PTPRJ | Q12913 | Yes | Yes | SIGNOR | SIGNOR:24583284 |
Page 3 of 3Previous
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass Spectrometry | 1 | 38037300 |
Sequence, Structure & Domains
Sequences
Length
1,337
Mass
145,941
Sequence
MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPSPVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPATSYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLLESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSRAGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAIEFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAVIPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAESFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVPSAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGTLYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLLIEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPASMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEVTYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGFEASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSEVLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRYSDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA
Alternative Products
Event=Alternative splicing, Alternative initiation; Named isoforms=3; Comment=Isoform 1 and isoform 3 result from alternative initiation of translation within the same 5' exon but produce the same functional protein following cleavage of their respective signal peptides (PubMed:18603590). Alternative initiation is probably a conserved mechanism in mammals to regulate the overall expression of that functional protein (PubMed:18603590, PubMed:33296397).; Name=1; IsoId=Q12913-1; Sequence=Displayed; Name=2; Synonyms=sPTPRJ; IsoId=Q12913-2; Sequence=VSP_043652, VSP_043653; Name=3; IsoId=Q12913-3; Sequence=VSP_060928
Alternative Sequence
1; M -> MSPGKPGAGGAGTRRTGWRRRRRRRRQEAATTVPGLGRTAGPDSRVRGTFQGARGM (in isoform 3); 539; V -> G (in isoform 2); 540..1337; Missing (in isoform 2)
3D Structural Models
Turn
1048..1054; 1058..1061; 1078..1080; 1117..1119; 1187..1189
Helix
272..276; 1023..1047; 1063..1068; 1090..1093; 1120..1129; 1212..1225; 1244..1261; 1267..1275; 1285..1302
Beta Strand
123..133; 135..140; 143..145; 150..155; 162..173; 181..193; 199..204; 211..216; 219..221; 223..228; 235..242; 256..262; 267..270; 327..332; 340..348; 358..363; 368..377; 382..389; 398..404; 409..420; 429..440; 446..451; 1087..1089; 1096..1100; 1108..1113; 1134..1138; 1155..1157; 1159..1161; 1164..1173; 1175..1186; 1192..1200; 1235..1243; 1262..1265
3D Structure
NMR spectroscopy (1); X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
67..82; Polar residues; 89..119; Polar residues
Domain (FT)
121..209; Fibronectin type-III 1; 207..291; Fibronectin type-III 2; 271..364; Fibronectin type-III 3; 368..456; Fibronectin type-III 4; 457..541; Fibronectin type-III 5; 542..623; Fibronectin type-III 6; 625..720; Fibronectin type-III 7; 721..817; Fibronectin type-III 8; 816..902; Fibronectin type-III 9; 1041..1298; Tyrosine-protein phosphatase
Region
67..124; Disordered; 278..327; Disordered
Protein Families (2)
- Protein-tyrosine phosphatase family
- Receptor class 3 subfamily
Sequence Similarities
Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.
Clinical Relevance
Antibody
Interaction Protein
ENSG00000198561
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 40326690 | Rapid Identification of Esophageal Squamous Cell Carcinoma Biomarkers by MALDI-TOF MS Fingerprinting of Extracellular Vesicles. | No related sentences available |