EV MemProt Atlas

Basic Information

Protein Names

Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)

Protein Class

CD markersEnzymesPlasma proteinsPredicted membrane proteinsPredicted secreted proteins

Protein Function

Enzymes
Predicted secreted proteins
CD markers
ENZYME proteins:Hydrolases

Transmembrane

976..996; Helical

Transmembrane Count

1

Ensembl

ENSG00000149177

Entrez Gene Symbol

PTPRJ

Gene Synonym

CD148DEP1HPTPeta

Gene Description

Protein tyrosine phosphatase receptor type J

Chromosome

11

Position

47980425-48170839

Frequency

1

EVMP Score

0.25

Fluorescence & Localization

Tissue SpecificlungCell SpecificKupffer cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificintermediate monocyteBlood Lineage SpecificmonocytesSecretome LocationSecreted to bloodSecretome FunctionReceptor

Function & Pathway

Protein Function

Enzymes
Predicted secreted proteins
CD markers
ENZYME proteins:Hydrolases

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Adhesion and uptake mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PTPRJ	SRC	P12931	Y	1,320	phosphorylation	Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:26556953
PTPRJ	SRC	P12931	Y	1,311	phosphorylation	Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:26556953
PTPRJ	FYN	P06241	Y	1,320	phosphorylation	Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:26556953
PTPRJ	FYN	P06241	Y	1,311	phosphorylation	Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:26556953

Ligand-Receptor Signaling

42 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	HGNC	No	Yes	Yes	Yes	No
receptor	receptor	GO_Intercell	No	Yes	Yes	Yes	No
receptor	receptor	HPMR	No	Yes	Yes	Yes	No
receptor	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	Surfaceome	No	Yes	Yes	Yes	No
receptor_like_protein_tyrosine_phosphatases_rptps	receptor	HPMR	No	Yes	Yes	Yes	No
rptpeta	receptor	HPMR	No	Yes	Yes	Yes	No
receptortypephosphatases	receptor	Surfaceome	No	Yes	Yes	Yes	No
cell_adhesion	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	OmniPath	No	Yes	Yes	Yes	No

Page 1 of 5Next

Regulatory Interaction Network

22 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PTPRJ	Q12913	SRC	P12931	Yes	Yes	Yes	WangKEGG-MEDICUSNCI-PID_ProtMapperSIGNORProtMapperDEPODSIGNOR_ProtMapper	DEPOD:15735685 ProtMapper:15735685 SIGNOR:22898603 ProtMapper:18936167 SIGNOR:24583284 DEPOD:20345711 SIGNOR:26556953 ProtMapper:10428027 SIGNOR:15735685
PTPRJ	Q12913	CEAM3	P40198	Yes	No	Yes	SIGNOR	SIGNOR:35850306
PTPRJ	Q12913	MK03	P27361	Yes	No	Yes	SIGNORProtMapperDEPODHINTIntActSIGNOR_ProtMapperLit-BM-17SPIKE_LC	IntAct:19167335 ProtMapper:19494114 SPIKE_LC:19167335 SPIKE_LC:19494114 SIGNOR:19494114 Lit-BM-17:19167335 IntAct:19494114 Lit-BM-17:19494114 SIGNOR:12771128 DEPOD:19494114 HINT:19494114
PTPRJ	Q12913	EGFR	P00533	Yes	Yes	No	SIGNORProtMapperDEPODREACH_ProtMapperHPRDHINTSIGNOR_ProtMapperLit-BM-17SPIKE_LC	SIGNOR:19836242 ProtMapper:32201537 SPIKE_LC:19167335 HINT:19836242 Lit-BM-17:19167335 Lit-BM-17:19836242 HPRD:9115287 ProtMapper:19836242 DEPOD:19836242
FYN	P06241	PTPRJ	Q12913	Yes	Yes	No	Sparser_ProtMapperiPTMnetSIGNORProtMapperREACH_ProtMapperPhosphoSite_ProtMapper	SIGNOR:22898603 ProtMapper:26556953
PTPRJ	Q12913	VGFR1	P17948	Yes	No	Yes	SIGNORIntAct	IntAct:16893970 SIGNOR:12771128 IntAct:12771128
PTPRJ	Q12913	JAK2	O60674	Yes	No	Yes	SIGNOR	SIGNOR:28912580
PTPRJ	Q12913	CTNB1	P35222	Yes	Yes	No	SIGNORHPRDHINTIntActSPIKE_LC	IntAct:19167335 SPIKE_LC:19167335 HPRD:12370829 IntAct:12370829 HINT:12370829 SIGNOR:25386896
PTPRJ	Q12913	P85A	P27986	Yes	No	Yes	SIGNORDEPOD	DEPOD:18348712 SIGNOR:18348712
PTPRJ	Q12913	FLT3	P36888	Yes	No	Yes	SIGNOR	SIGNOR:21262971

Page 2 of 3Previous Next

Protein Complex Composition

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	PTPRJ	Q12913	4	PDB	PDB:7u01

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass Spectrometry	1	38037300

Sequence, Structure & Domains

Sequences

Length

1,337

Mass

145,941

Sequence

MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPSPVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPATSYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLLESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSRAGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAIEFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAVIPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAESFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVPSAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGTLYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLLIEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPASMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEVTYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGFEASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSEVLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRYSDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA

Alternative Products

Event=Alternative splicing, Alternative initiation; Named isoforms=3; Comment=Isoform 1 and isoform 3 result from alternative initiation of translation within the same 5' exon but produce the same functional protein following cleavage of their respective signal peptides (PubMed:18603590). Alternative initiation is probably a conserved mechanism in mammals to regulate the overall expression of that functional protein (PubMed:18603590, PubMed:33296397).; Name=1; IsoId=Q12913-1; Sequence=Displayed; Name=2; Synonyms=sPTPRJ; IsoId=Q12913-2; Sequence=VSP_043652, VSP_043653; Name=3; IsoId=Q12913-3; Sequence=VSP_060928

Alternative Sequence

1; M -> MSPGKPGAGGAGTRRTGWRRRRRRRRQEAATTVPGLGRTAGPDSRVRGTFQGARGM (in isoform 3); 539; V -> G (in isoform 2); 540..1337; Missing (in isoform 2)

3D Structural Models

Turn

1048..1054; 1058..1061; 1078..1080; 1117..1119; 1187..1189

Helix

272..276; 1023..1047; 1063..1068; 1090..1093; 1120..1129; 1212..1225; 1244..1261; 1267..1275; 1285..1302

Beta Strand

123..133; 135..140; 143..145; 150..155; 162..173; 181..193; 199..204; 211..216; 219..221; 223..228; 235..242; 256..262; 267..270; 327..332; 340..348; 358..363; 368..377; 382..389; 398..404; 409..420; 429..440; 446..451; 1087..1089; 1096..1100; 1108..1113; 1134..1138; 1155..1157; 1159..1161; 1164..1173; 1175..1186; 1192..1200; 1235..1243; 1262..1265

3D Structure

NMR spectroscopy (1); X-ray crystallography (4)

Domain & Motif Annotations

Compositional Bias

67..82; Polar residues; 89..119; Polar residues

Domain (FT)

121..209; Fibronectin type-III 1; 207..291; Fibronectin type-III 2; 271..364; Fibronectin type-III 3; 368..456; Fibronectin type-III 4; 457..541; Fibronectin type-III 5; 542..623; Fibronectin type-III 6; 625..720; Fibronectin type-III 7; 721..817; Fibronectin type-III 8; 816..902; Fibronectin type-III 9; 1041..1298; Tyrosine-protein phosphatase

Region

67..124; Disordered; 278..327; Disordered

Protein Families

Protein-tyrosine phosphatase family
Receptor class 3 subfamily

Sequence Similarities

Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.

Clinical Relevance

Antibody

HPA006026

Interaction Protein

ENSG00000198561

Interaction Count

1

Interaction Dataset

intact_biogrid

Protein symbol PTPRJ	UniProt ID Q12913	EVMP score 0.25
Frequency 1	Transmembrane count 1	Protein classification CD markersEnzymesPlasma proteinsPredicted membrane proteinsPredicted secreted proteins