Protein detail
EPS8
Epidermal growth factor receptor kinase substrate 8
Entry name EPS8 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 11 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Epidermal growth factor receptor kinase substrate 8
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Ear disease
Ensembl
Entrez Gene Symbol
Gene Description
Epidermal growth factor receptor pathway substrate 8
Chromosome
12
Position
15620134-15882329
Supporting publications (n)
11
EVMP confidence score
0.72
Fluorescence & Localization
Function & Pathway
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Ear disease
Cellular Component (12)
- GO:0005886 plasma membrane
- GO:0005903 brush border
- GO:0005938 cell cortex
- GO:0014069 postsynaptic density
- GO:0017146 NMDA selective glutamate receptor complex
- GO:0030426 growth cone
- GO:0031982 vesicle
- GO:0032420 stereocilium
- GO:0032426 stereocilium tip
- GO:0032587 ruffle membrane
Page 1 of 2
Molecular Function (3)
Biological Process (3)
Reactome (3)
Mediation Categories (3)
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence27
Enzyme-Mediated Modification (8)
8 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| EPS8 | PTK6 | Q13882 | Y | 535 | phosphorylation | SIGNOR | SIGNOR:28214294 |
| EPS8 | PTK6 | Q13882 | Y | 498 | phosphorylation | REACH_ProtMapperSIGNORProtMapper | ProtMapper:28214294SIGNOR:27738316 |
| EPS8 | PTK6 | Q13882 | Y | 525 | phosphorylation | REACH_ProtMapperSIGNORProtMapper | ProtMapper:28214294SIGNOR:28214294 |
| EPS8 | MAPK3 | P27361 | S | 625 | phosphorylation | SIGNOR | SIGNOR:19564905 |
| EPS8 | SRC | P12931 | Y | 485 | phosphorylation | PhosphoSite | |
| EPS8 | SRC | P12931 | Y | 774 | phosphorylation | PhosphoSite | |
| EPS8 | SRC | P12931 | Y | 525 | phosphorylation | PhosphoSite | |
| EPS8 | SRC | P12931 | Y | 602 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MK03 | P27361 | EPS8 | Q12929 | Yes | Yes | SIGNOR_ProtMapperiPTMnetSIGNORProtMapper | SIGNOR:19564905ProtMapper:19564905 | |
| PTK6 | Q13882 | EPS8 | Q12929 | Yes | Yes | iPTMnetSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapper | ProtMapper:28214294SIGNOR:27738316ProtMapper:27738316SIGNOR:28214294 | |
| SRC | P12931 | EPS8 | Q12929 | Yes | Yes | WangPhosphoSite_norefPhosphoPointProtMapperHPRDCui2007SPIKE_LCPhosphoSitePhosphoSite_ProtMapper | SPIKE_LC:16189514HPRD:10395945PhosphoSite:32641864PhosphoSite:23626693 |
Protein Complex Composition (10)
10 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 27821849 |
Sequence, Structure & Domains
Sequences
Length
822
Mass
91,882
Sequence
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q12929-1; Sequence=Displayed; Name=2; IsoId=Q12929-2; Sequence=VSP_056460
Alternative Sequence
1..260; Missing (in isoform 2)
3D Structural Models
Helix
582..584; 729..737; 741..746; 752..757; 760..766; 770..784
Beta Strand
535..540; 557..562; 564..571; 577..581; 585..587; 748..750
3D Structure
NMR spectroscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
1..10; Polar residues; 17..30; Polar residues; 208..221; Pro residues; 299..309; Basic residues; 618..645; Pro residues; 671..687; Basic and acidic residues
Domain (CC)
The effector region is required for activating the Rac-specific guanine nucleotide exchange factor (GEF) activity. It mediates both barbed-end actin capping and actin bundling activities. The capping activity is mediated by an amphipathic helix that binds within the hydrophobic pocket at the barbed ends of actin blocking further addition of actin monomers, while the bundling activity is mediated by a compact 4 helix bundle, which contacts 3 actin subunits along the filament (By similarity).; DOMAIN: The SH3 domain mediates interaction with SHB.
Domain (FT)
64..194; PTB; 531..590; SH3
Region
1..39; Disordered; 202..225; Disordered; 298..320; Disordered; 612..689; Disordered; 649..822; Effector region; 680..698; Amphipathic helix; 718..738; Helix bundle 1; 752..757; Helix bundle 2; 762..767; Helix bundle 3; 766..785; Helix bundle 4; 787..822; Disordered
Protein Families
EPS8 family
Sequence Similarities
Belongs to the EPS8 family.
Clinical Relevance
Disease Involvement (2)
DeafnessNon-syndromic deafness
Related Diseases (2)
Drugs (21)
Interaction Protein (5)
ENSG00000006453ENSG00000110395ENSG00000146648ENSG00000164904ENSG00000175866
Interaction Count
5
Interaction Dataset
intact_biogrid