Protein detail
DLG1
Disks large homolog 1 (Synapse-associated protein 97) (SAP-97) (SAP97) (hDlg)
Entry name DLG1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Predicted intracellular proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Disks large homolog 1 (Synapse-associated protein 97) (SAP-97) (SAP97) (hDlg)
Protein Class (2)
Predicted intracellular proteinsTransporters
Protein Function (2)
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
dJ1061C18.1.1DLGH1hdlgSAP-97SAP97
Gene Description
Discs large MAGUK scaffold protein 1
Chromosome
3
Position
197042560-197299330
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization6
Tissue Specificadipose tissueCell SpecificLymphatic endothelial cellsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway8
Protein Function (2)
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
Cellular Component (33)
- GO:0001772 immunological synapse
- GO:0005604 basement membrane
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005783 endoplasmic reticulum
- GO:0005789 endoplasmic reticulum membrane
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005874 microtubule
- GO:0005886 plasma membrane
Page 1 of 4
Molecular Function (14)
- GO:0004385 guanylate kinase activity
- GO:0004721 phosphoprotein phosphatase activity
- GO:0005515 protein binding
- GO:0008092 cytoskeletal protein binding
- GO:0015459 potassium channel regulator activity
- GO:0019900 kinase binding
- GO:0019901 protein kinase binding
- GO:0019902 phosphatase binding
- GO:0035255 ionotropic glutamate receptor binding
- GO:0044325 transmembrane transporter binding
Page 1 of 2
Biological Process (3)
KEGG (6)
Reactome (20)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-442755 activation of nmda receptors and postsynaptic events
- R-hsa-9609736 assembly and cell surface presentation of nmda receptors
- R-hsa-442742 creb1 phosphorylation through nmda receptor mediated activation of ras signaling
- R-hsa-451306 ionotropic activity of kainate receptors
- R-hsa-373760 l1cam interactions
- R-hsa-9620244 long term potentiation
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-9617324 negative regulation of nmda receptor mediated neuronal transmission
Page 1 of 2
Canonical Pathways
M15 Pid lysophospholipid pathway
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence49
Enzyme-Mediated Modification (19)
19 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DLG1 | CDK2 | P24941 | S | 158 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19066288SIGNOR:19066288 |
| DLG1 | CDK2 | P24941 | S | 443 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19066288SIGNOR:19066288 |
| DLG1 | CAMK2A | Q9UQM7 | S | 232 | phosphorylation | phosphoELM_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | SIGNOR:12933808KEA:12933808HPRD:12933808ProtMapper:12933808 |
| DLG1 | CDK1 | P06493 | S | 443 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19066288SIGNOR:19066288 |
| DLG1 | CDK1 | P06493 | S | 158 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19066288SIGNOR:19066288 |
| DLG1 | MAPK13 | O15264 | S | 122 | phosphorylation | PhosphoSite | |
| DLG1 | MAPK13 | O15264 | T | 209 | phosphorylation | PhosphoSite | |
| DLG1 | MAPK13 | O15264 | S | 158 | phosphorylation | PhosphoSite | |
| DLG1 | MAPK12 | P53778 | S | 443 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| DLG1 | MAPK12 | P53778 | T | 209 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper |
Page 1 of 2Next
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adherens_junction | adherens_junction | OmniPath | No | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apical_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Page 2 of 2Previous
Regulatory Interaction Network (7)
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| DLG1 | Q12959 | MK14 | Q16539 | Yes | No | No | SignaLink3TCRcuration_SignaLink3 | SignaLink3:23109003SignaLink3:17187070 |
| EPB41 | P11171 | DLG1 | Q12959 | Yes | Yes | No | SIGNORHPRDCui2007CA1Wang | SIGNOR:12807908CA1:7937897HPRD:7937897 |
| KCC2A | Q9UQM7 | DLG1 | Q12959 | Yes | Yes | Yes | WangphosphoELM_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDCui2007PhosphoSite_KEAKEACA1HPRD_KEASIGNOR_ProtMapperHPRD-phos | SIGNOR:12933808KEA:12933808CA1:15044483ProtMapper:12933808HPRD-phos:12933808HPRD:12933808CA1:12933808 |
| DLG1 | Q12959 | ZAP70 | P43403 | Yes | Yes | No | WangSIGNOR | SIGNOR:34960191 |
| CDK2 | P24941 | DLG1 | Q12959 | Yes | Yes | No | Sparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSite_ProtMapper | ProtMapper:19066288ELM:19066288SIGNOR:19066288 |
| MK12 | P53778 | DLG1 | Q12959 | Yes | No | No | Sparser_ProtMapperPhosphoSite_norefPhosphoPointiPTMnetProtMapperHPRDBioGRIDPhosphoSitePhosphoSite_ProtMapper | BioGRID:27416801PhosphoSite:19066288HPRD:16637659PhosphoSite:20643107PhosphoSite:19307009PhosphoSite:15729360ProtMapper:20643107 |
| KPCA | P17252 | DLG1 | Q12959 | Yes | No | No | iPTMnetPhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:22027822 |
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LIN2-SAP97 complex | CASKDLG1 | O14936Q12959 | 1:1 | CompleatCORUM | Compleat:HC1495CORUM:3209 | 11865057 |
| MPP7-DLG1-LIN7 complex | DLG1MPP7 | Q12959Q5T2T1 | 1:1 | Compleat | Compleat:HC1754 | 17237226 |
| DLG1KCNA1MFN2PRKNRHOT1 | O60260O95140Q09470Q12959Q8IXI2 | 1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7117 | ||
| DLG1DLG3NFATC2IPTCEA1 | P23193Q12959Q8NCF5Q92796 | 0:0:0:0 | hu.MAP2 | |||
| DLG1 | Q12959 | 2 | PDB | PDB:4amh | ||
| DLG1DLG3TEAD4 | Q12959Q15561Q92796 | 0:0:0 | hu.MAP | |||
| DLG1DLG3 | Q12959Q92796 | 0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass Spectrometry | 1 | 38037300 |
Sequence, Structure & Domains15
Sequences
Length
904
Mass
100,455
Sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL
Alternative Products
Event=Alternative splicing; Named isoforms=9; Name=1; IsoId=Q12959-1; Sequence=Displayed; Name=2; IsoId=Q12959-2; Sequence=VSP_003150; Name=3; IsoId=Q12959-3; Sequence=VSP_012862; Name=4; IsoId=Q12959-4; Sequence=VSP_012862, VSP_003150; Name=5; IsoId=Q12959-5; Sequence=VSP_012862, VSP_012863; Name=6; IsoId=Q12959-6; Sequence=VSP_012864; Name=7; IsoId=Q12959-7; Sequence=VSP_012865; Name=8; IsoId=Q12959-8; Sequence=VSP_045896, VSP_045897; Name=9; IsoId=Q12959-9; Sequence=VSP_045896, VSP_045897, VSP_012865, VSP_045898
Alternative Sequence
1..77; MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQ -> MNYIFGNNTLLYSRGSRGGNTSSSHGSAGPKQKHWAKKGSSDELQAEPEPSRWQQIVAFFTRRHSFIDCISVATSST (in isoform 8 and isoform 9); 78..193; Missing (in isoform 8 and isoform 9); 162..194; Missing (in isoform 3, isoform 4 and isoform 5); 195..212; Missing (in isoform 5); 669..680; EIPDDMGSKGLK -> QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ (in isoform 2 and isoform 4); 681..693; Missing (in isoform 6); 693; Y -> YLILITDEYGCSKG (in isoform 7 and isoform 9); 694; Missing (in isoform 9)
3D Structural Models
Turn
60..62; 736..738; 756..758; 801..803
Helix
5..20; 30..42; 44..55; 64..66; 263..267; 289..297; 358..362; 384..392; 499..503; 525..533; 547..554; 724..734; 766..774; 793..800; 813..820; 855..864; 865..867; 877..892; 900..902
Beta Strand
24..26; 220..228; 235..240; 253..259; 275..279; 301..310; 317..323; 328..335; 348..353; 355..357; 370..374; 377..382; 396..403; 465..470; 472..474; 477..482; 484..487; 489..494; 510..515; 537..545; 717..721; 778..784; 787..792; 805..808; 826..830; 869..872
3D Structure
NMR spectroscopy (2); X-ray crystallography (11)
Domain & Motif Annotations
Compositional Bias
682..693; Polar residues
Domain (CC)
The alternatively spliced domain I3 corresponding to amino acids (636-669) of isoform 4 is an EPB41 binding site mediating association to membranes in polarized and non-polarized cells.; DOMAIN: The PDZ domains may also mediate association to membranes by binding to EPB41 and ADGRA2 together with the L27 domain that binds CASK and DLG2..; DOMAIN: The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization.
Domain (FT)
4..64; L27; 224..310; PDZ 1; 319..405; PDZ 2; 466..546; PDZ 3; 581..651; SH3; 714..889; Guanylate kinase-like
Region
162..212; Interaction with SH3 domains; 224..546; Required for interaction with MARCHF2; 662..693; Disordered
Protein Families
MAGUK family
Sequence Similarities
Belongs to the MAGUK family.
Clinical Relevance4
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |