Protein detail
PAK1
Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)
Protein symbol PAK1 | UniProt ID | EVMP score 0.50 |
Frequency 4 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)
Protein Class
Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins
Protein Function
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Kinases:STE Ser/Thr protein kinases
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Description
P21 (RAC1) activated kinase 1
Chromosome
11
Position
77322017-77474635
Frequency
4
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificliverCell SpecificAstrocytesBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Kinases:STE Ser/Thr protein kinases
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Disease related genes
Cellular Component
- GO:0001726 ruffle
- GO:0005654 nucleoplasm
- GO:0005694 chromosome
- GO:0005737 cytoplasm
- GO:0005813 centrosome
- GO:0005829 cytosol
- GO:0005884 actin filament
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005925 focal adhesion
- GO:0014704 intercalated disc
- GO:0030018 Z disc
- GO:0030027 lamellipodium
- GO:0030424 axon
- GO:0030425 dendrite
- GO:0031965 nuclear membrane
- GO:0032587 ruffle membrane
- GO:0032991 protein-containing complex
Molecular Function
- GO:0004672 protein kinase activity
- GO:0004674 protein serine/threonine kinase activity
- GO:0005515 protein binding
- GO:0005518 collagen binding
- GO:0005524 ATP binding
- GO:0031267 small GTPase binding
- GO:0042802 identical protein binding
- GO:0043015 gamma-tubulin binding
- GO:0044024 histone H2AS1 kinase activity
- GO:0106310 protein serine kinase activity
Biological Process
KEGG
- hsa04010 MAPK signaling pathway
- KEGG:hsa04012 ErbB signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04392 Hippo signaling pathway - multiple species
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04625 C-type lectin receptor signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05120 Epithelial cell signaling in Helicobacter pylori infection
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05132 Salmonella infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05211 Renal cell carcinoma
Reactome
- R-hsa-428540 activation of rac1
- R-hsa-1280218 adaptive immune system
- R-hsa-5621575 cd209 dc sign signaling
- R-hsa-389359 cd28 dependent vav1 pathway
- R-hsa-9013148 cdc42 gtpase cycle
- R-hsa-389356 co stimulation by cd28
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-3928664 ephrin signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-2871796 fceri mediated mapk activation
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-8964616 g beta gamma signalling through cdc42
- R-hsa-397795 g protein beta gamma signalling
- R-hsa-168249 innate immune system
- R-hsa-373760 l1cam interactions
- R-hsa-5687128 mapk6 mapk4 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-397014 muscle contraction
- R-hsa-9675108 nervous system development
- R-hsa-9013149 rac1 gtpase cycle
- R-hsa-9013404 rac2 gtpase cycle
- R-hsa-9013423 rac3 gtpase cycle
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-9013407 rhoh gtpase cycle
- R-hsa-9013409 rhoj gtpase cycle
- R-hsa-9013406 rhoq gtpase cycle
- R-hsa-9013420 rhou gtpase cycle
- R-hsa-9013424 rhov gtpase cycle
- R-hsa-5627123 rho gtpases activate paks
- R-hsa-5625740 rho gtpases activate pkns
- R-hsa-5627117 rho gtpases activate rocks
- R-hsa-9012999 rho gtpase cycle
- R-hsa-195258 rho gtpase effectors
- R-hsa-399954 sema3a pak dependent axon repulsion
- R-hsa-373755 semaphorin interactions
- R-hsa-372790 signaling by gpcr
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-376176 signaling by robo receptors
- R-hsa-194138 signaling by vegf
- R-hsa-445144 signal transduction by l1
- R-hsa-445355 smooth muscle contraction
- R-hsa-202403 tcr signaling
- R-hsa-5218920 vegfr2 mediated vascular permeability
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
92 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PAK1 | JAK2 | O60674 | Y | 285 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPProtMapperRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:25472536ProtMapper:25466889 |
| PAK1 | JAK2 | O60674 | Y | 153 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:25472536ProtMapper:26944939ProtMapper:27542844ProtMapper:25466889ProtMapper:17726028 |
| PAK1 | JAK2 | O60674 | Y | 201 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperRLIMS-P_ProtMapperKEAPhosphoSitePhosphoSite_ProtMapper | ProtMapper:27542844KEA:17726028ProtMapper:17726028 |
| PAK1 | MAP3K11 | Q16584 | S | 204 | phosphorylation | REACH_ProtMapperPhosphoSiteProtMapper | ProtMapper:30664689 |
| PAK1 | MAP3K11 | Q16584 | S | 133 | phosphorylation | REACH_ProtMapperPhosphoSiteProtMapper | ProtMapper:30664689 |
| PAK1 | CDK1 | P06493 | T | 212 | phosphorylation | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEAREACH_ProtMapper | ProtMapper:19465939KEA:11604394ProtMapper:19165420ProtMapper:19298660KEA:17570479KEA:12176333KEA:17114649 |
| PAK1 | CDK2 | P24941 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK2 | P24941 | S | 220 | phosphorylation | KEA | KEA:17570479 |
| PAK1 | CDK3 | Q00526 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK10 | Q15131 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP |
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network
84 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PAK1 | Q13153 | MYLK | Q15746 | Yes | No | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAInnateDBPhosphoNetworksHPRDCui2007CA1WangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAReactome_ProtMapperHPRD-phos | HPRD-phos:10092231InnateDB:10092231HPRD:10092231CA1:10092231ProtMapper:10092231SIGNOR:10092231KEA:10092231 |
| OXSR1 | O95747 | PAK1 | Q13153 | Yes | No | Yes | Sparser_ProtMapperMIMPHPRD_MIMPiPTMnetSIGNORProtMapperHPRDRLIMS-P_ProtMapperPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapper | KEA:14707132HPRD:14707132ProtMapper:18676754ProtMapper:14707132SIGNOR:14707132 |
| PAK1 | Q13153 | MINT | Q96T58 | Yes | No | Yes | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetRLIMS-P_ProtMapperInnateDBREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:15824732ProtMapper:32863957ProtMapper:15824732InnateDB:15824732PhosphoSite:15824732 |
| PAK1 | Q13153 | SRC8 | Q14247 | Yes | Yes | No | WangSparser_ProtMapperphosphoELM_MIMPAdhesomeMIMPPhosphoSite_MIMPHPRD_MIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperReactome_ProtMapperInnateDBSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperSPIKE_LC | SPIKE_LC:18344974InnateDB:12453877ProtMapper:27135389ProtMapper:20444238ProtMapper:21079800Adhesome:18344974ProtMapper:24859002SIGNOR:21079800ProtMapper:29172953ProtMapper:29152154Adhesome:12453877Adhesome:16854367ProtMapper:26490115SIGNOR:20444238PhosphoSite:30562756PhosphoSite:24859002 |
| PP2AA | P67775 | PAK1 | Q13153 | Yes | No | Yes | WangAdhesomeSIGNORProtMapperDEPODSIGNOR_ProtMapper | SIGNOR:18586681ProtMapper:18586681DEPOD:10322434DEPOD:18586681Adhesome:9873003 |
| PAK1 | Q13153 | ILK | Q13418 | Yes | Yes | No | WangSparser_ProtMapperAdhesomeMIMPPhosphoSite_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperRLIMS-P_ProtMapperKinexus_KEAKEAInnateDBSIGNOR_ProtMapperREACH_ProtMapperPhosphoSite_ProtMapper | InnateDB:17420447ProtMapper:22521536SIGNOR:17420447ProtMapper:27642646ProtMapper:17420447Adhesome:17420447ProtMapper:25738875KEA:17420447 |
| PAK1 | Q13153 | BCL6 | P41182 | Yes | No | Yes | SIGNOR | SIGNOR:22723377 |
| PPM1A | P35813 | PAK1 | Q13153 | Yes | No | Yes | SIGNOR_ProtMapperSIGNORProtMapperDEPOD | DEPOD:18586681SIGNOR:18586681ProtMapper:18586681 |
| PAK1 | Q13153 | NLRP3 | Q96P20 | Yes | Yes | No | PhosphoSite_norefSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:33432150PhosphoSite:33432150PhosphoSite:28943315 |
| STK11 | Q15831 | PAK1 | Q13153 | Yes | No | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:20400510SIGNOR:20400510 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | R SequencingMass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
545
Mass
60,647
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q13153-1; Sequence=Displayed; Name=2; Synonyms=PAK1B; IsoId=Q13153-2; Sequence=VSP_017507
Alternative Sequence
518..545; HQFLKIAKPLSSLTPLIAAAKEATKNNH -> VRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS (in isoform 2)
3D Structural Models
Turn
91..94; 290..292; 463..466; 506..508
Helix
101..108; 114..119; 121..135; 250..260; 266..268; 303..305; 309..321; 352..358; 363..382; 392..394; 428..430; 433..437; 444..459; 469..479; 487..489; 492..501; 512..515; 519..523; 527..530; 531..540
Beta Strand
79..87; 95..98; 195..198; 214..219; 261..264; 270..272; 274..279; 282..289; 295..302; 330..336; 339..345; 349..351; 395..397; 403..405; 408..410; 416..418
3D Structure
NMR spectroscopy (1); X-ray crystallography (36)
Domain & Motif Annotations
Compositional Bias
68..77; Basic and acidic residues; 174..184; Acidic residues; 220..231; Polar residues
Domain (FT)
75..88; CRIB; 270..521; Protein kinase
Region
1..77; Disordered; 70..140; Autoregulatory region; 75..105; GTPase-binding; 159..198; Disordered; 211..251; Disordered
Protein Families
- Protein kinase superfamily
- STE Ser/Thr protein kinase family
- STE20 subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Clinical Relevance
Disease Involvement
Disease variantEpilepsyIntellectual disability
Drugs
Interaction Protein
ENSG00000070831ENSG00000071051ENSG00000088986ENSG00000102606ENSG00000106683ENSG00000108262ENSG00000116574ENSG00000126785ENSG00000129675ENSG00000136238ENSG00000139436ENSG00000146648
Interaction Count
12
Interaction Dataset
intact_biogridintact_biogrid_opencell