Protein detail
PAK1
Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)
Entry name PAK1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)
Protein Class (7)
Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins
Protein Function (8)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Kinases:STE Ser/Thr protein kinases
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Description
P21 (RAC1) activated kinase 1
Chromosome
11
Position
77322017-77474635
Supporting publications (n)
4
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificliverCell SpecificAstrocytesBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (8)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Kinases:STE Ser/Thr protein kinases
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- RAS pathway related proteins
- Enzymes
- Disease related genes
Cellular Component (18)
- GO:0001726 ruffle
- GO:0005654 nucleoplasm
- GO:0005694 chromosome
- GO:0005737 cytoplasm
- GO:0005813 centrosome
- GO:0005829 cytosol
- GO:0005884 actin filament
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005925 focal adhesion
Page 1 of 2
Molecular Function (10)
- GO:0004672 protein kinase activity
- GO:0004674 protein serine/threonine kinase activity
- GO:0005515 protein binding
- GO:0005518 collagen binding
- GO:0005524 ATP binding
- GO:0031267 small GTPase binding
- GO:0042802 identical protein binding
- GO:0043015 gamma-tubulin binding
- GO:0044024 histone H2AS1 kinase activity
- GO:0106310 protein serine kinase activity
Biological Process (3)
KEGG (20)
- hsa04010 MAPK signaling pathway
- KEGG:hsa04012 ErbB signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04392 Hippo signaling pathway - multiple species
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04625 C-type lectin receptor signaling pathway
Page 1 of 2
Reactome (47)
- R-hsa-428540 activation of rac1
- R-hsa-1280218 adaptive immune system
- R-hsa-5621575 cd209 dc sign signaling
- R-hsa-389359 cd28 dependent vav1 pathway
- R-hsa-9013148 cdc42 gtpase cycle
- R-hsa-389356 co stimulation by cd28
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-3928664 ephrin signaling
- R-hsa-2682334 eph ephrin signaling
Page 1 of 5
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence198
Enzyme-Mediated Modification (92)
92 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PAK1 | CDK4 | P11802 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK6 | Q00534 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK7 | P50613 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK8 | P49336 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK11B | P21127 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK11B | P21127 | S | 174 | phosphorylation | RLIMS-P_ProtMapperProtMapper | ProtMapper:19520772 |
| PAK1 | CDK9 | P50750 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK13 | Q14004 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK12 | Q9NYV4 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PAK1 | CDK16 | Q00536 | T | 212 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Regulatory Interaction Network (84)
84 records.
Protein Complex Composition (12)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | R SequencingMass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
545
Mass
60,647
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q13153-1; Sequence=Displayed; Name=2; Synonyms=PAK1B; IsoId=Q13153-2; Sequence=VSP_017507
Alternative Sequence
518..545; HQFLKIAKPLSSLTPLIAAAKEATKNNH -> VRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS (in isoform 2)
3D Structural Models
Turn
91..94; 290..292; 463..466; 506..508
Helix
101..108; 114..119; 121..135; 250..260; 266..268; 303..305; 309..321; 352..358; 363..382; 392..394; 428..430; 433..437; 444..459; 469..479; 487..489; 492..501; 512..515; 519..523; 527..530; 531..540
Beta Strand
79..87; 95..98; 195..198; 214..219; 261..264; 270..272; 274..279; 282..289; 295..302; 330..336; 339..345; 349..351; 395..397; 403..405; 408..410; 416..418
3D Structure
NMR spectroscopy (1); X-ray crystallography (36)
Domain & Motif Annotations
Compositional Bias
68..77; Basic and acidic residues; 174..184; Acidic residues; 220..231; Polar residues
Domain (FT)
75..88; CRIB; 270..521; Protein kinase
Region
1..77; Disordered; 70..140; Autoregulatory region; 75..105; GTPase-binding; 159..198; Disordered; 211..251; Disordered
Protein Families (3)
- Protein kinase superfamily
- STE Ser/Thr protein kinase family
- STE20 subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Clinical Relevance
Disease Involvement (3)
Disease variantEpilepsyIntellectual disability
Related Diseases (2)
Drugs (10)
Interaction Protein (12)
ENSG00000070831ENSG00000071051ENSG00000088986ENSG00000102606ENSG00000106683ENSG00000108262ENSG00000116574ENSG00000126785ENSG00000129675ENSG00000136238ENSG00000139436ENSG00000146648
Interaction Count
12
Interaction Dataset (2)
intact_biogridintact_biogrid_opencell
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 30301952 | A position on vision. | No related sentences available |
| 38343172 | Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles. | No related sentences available |
| 40222457 | Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement. | No related sentences available |
| 40595564 | Enrichment of extracellular vesicles using Mag-Net for the analysis of the plasma proteome. | No related sentences available |