Protein detail

PAK1

Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)

Entry name PAK1	UniProt ID Q13153	EVMP confidence score 0.40
Supporting publications (n) 4	Transmembrane count	Protein classification Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins

Basic Information

Protein Names

Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)

Protein Class (7)

Disease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins

Protein Function (8)

Human disease related genes:Other diseases:Mental and behavioural disorders
Kinases:STE Ser/Thr protein kinases
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
RAS pathway related proteins
Enzymes
Disease related genes

Ensembl

ENSG00000149269

Entrez Gene Symbol

PAK1

Gene Description

P21 (RAC1) activated kinase 1

Chromosome

Position

77322017-77474635

Supporting publications (n)

EVMP confidence score

0.40

Fluorescence & Localization

Tissue SpecificliverCell SpecificAstrocytesBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes

Function & Pathway

Protein Function (8)

Human disease related genes:Other diseases:Mental and behavioural disorders
Kinases:STE Ser/Thr protein kinases
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
RAS pathway related proteins
Enzymes
Disease related genes

Cellular Component (18)

Page 1 of 2

Molecular Function (10)

Biological Process (3)

KEGG (20)

Page 1 of 2

Reactome (47)

Page 1 of 5

Mediation Categories (4)

Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence198

Enzyme-Mediated Modification (92)

92 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PAK1	PPM1A	P35813	S	199	dephosphorylation	SIGNOR	SIGNOR:18586681
PAK1	PPM1A	P35813	T	423	dephosphorylation	SIGNOR	SIGNOR:18586681
PAK1	PPM1A	P35813	T	423	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:18586681
PAK1	PPM1A	P35813	S	199	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:18586681
PAK1	PPM1A	P35813	S	57	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:18586681
PAK1	PPM1F	P49593	T	423	dephosphorylation	SIGNOR	SIGNOR:11864573
PAK1	PPM1F	P49593	S	57	dephosphorylation	SIGNOR	SIGNOR:11864573
PAK1	PPP2CB	P62714	T	423	dephosphorylation	SIGNOR	SIGNOR:18586681
PAK1	PPP2CB	P62714	S	57	dephosphorylation	SIGNOR	SIGNOR:18586681
PAK1	PPP2CB	P62714	S	199	dephosphorylation	SIGNOR	SIGNOR:18586681

Page 2 of 10Previous Next

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Receiver
receptor	receptor	OmniPath	Yes
intracellular	intracellular	LOCATE
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	UniProt_location
intracellular	intracellular	OmniPath
plasma_membrane	plasma_membrane	UniProt_location
plasma_membrane	plasma_membrane	OmniPath
receptor	receptor	scConnect	Yes

Regulatory Interaction Network (84)

84 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PAK1	Q13153	DYL1	P63167	Yes		Yes	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperHINTphosphoELM_KEALit-BM-17HPRDIntActLMPIDPhosphoSite_ProtMapperPhosphoSite_MIMPMIMPiPTMnetKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteSparser_ProtMapper	PhosphoSite:19863079 PhosphoSite:21062069 Lit-BM-17:15193260 IntAct:32814053 ProtMapper:24529727 ProtMapper:19557173 SIGNOR:18084006 ProtMapper:20507214 HPRD:15193260 Lit-BM-17:21988832 LMPID:20889982 HINT:17389360 ProtMapper:15504720 PhosphoSite:15193260 LMPID:15193260 PhosphoSite:18084006 ProtMapper:15642175 ProtMapper:18650427 ProtMapper:18084006 PhosphoSite:19289209 ProtMapper:15193260 KEA:15504720 IntAct:21988832 PhosphoSite:30464262 PhosphoSite:18650427 PhosphoSite:23038268 HINT:15193260
PAK1	Q13153	PLK1	P53350	Yes	Yes		WangPhosphoSite_MIMPMIMPNCI-PID_ProtMapperiPTMnetSIGNORProtMapperKinexus_KEAKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:18427546 PhosphoSite:18427546 ProtMapper:26779436 ProtMapper:18427546 KEA:18427546
MK01	P28482	PAK1	Q13153	Yes	Yes	Yes	HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangBEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperSparser_ProtMapperAdhesome	ProtMapper:15542607 KEA:16964243 KEA:11604394 ProtMapper:11604394 SIGNOR:15542607 ProtMapper:15212693 ProtMapper:20058876 KEA:15542607 Adhesome:15542607 HPRD:15542607 ProtMapper:19604315 ProtMapper:19664994 ProtMapper:19413330 ProtMapper:19664995 phosphoELM:15542607 Adhesome:11604394
EPHA3	P29320	PAK1	Q13153	Yes	Yes		REACH_ProtMapperSIGNORSparser_ProtMapperProtMapper	SIGNOR:26944939 ProtMapper:26944939
PAK1	Q13153	MORC2	Q9Y6X9	Yes	Yes		Sparser_ProtMapperiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:25888627 PhosphoSite:23260667 ProtMapper:32863957 ProtMapper:29597073 ProtMapper:23260667 SIGNOR:25888627 PhosphoSite:25888627 SIGNOR:23260667 ProtMapper:26476214
PAK1	Q13153	AJUBA	Q96IF1	Yes	Yes		SIGNOR	SIGNOR:22105346
PAK1	Q13153	FXR1	P51114	Yes	Yes		Sparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSite_ProtMapper	ProtMapper:20417602 SIGNOR:20417602
PAK1	Q13153	GDIR1	P52565	Yes	Yes	Yes	SIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksNCI-PID_ProtMapperWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteSparser_ProtMapper	ProtMapper:15225553 PhosphoSite:24820414 PhosphoSite:18768928 PhosphoSite:29873699 ProtMapper:29121646 KEA:15225553 PhosphoSite:29121646 SIGNOR:15225553 PhosphoSite:32003021 phosphoELM:15225553 PhosphoSite:20028975 PhosphoSite:15225553 ProtMapper:29307615
	COMPLEX:P30281_Q9UQ88	PAK1	Q13153	Yes	Yes		SIGNOR	SIGNOR:19520772
PAK1	Q13153	WEE1	P30291	Yes		Yes	SIGNOR	SIGNOR:15037762

Page 6 of 9Previous Next

Protein Complex Composition (12)

12 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
ARHGEF7-GIT2-PAK1 complex	ARHGEF7 GIT2 PAK1	Q13153 Q14155 Q14161	0:0:0	CORUM	CORUM:6928	11157752
Cdc42p/Ste20p complex	CDC42 PAK1 PAK2 PAK3 PAK6	O75914 P60953 Q13153 Q13177 Q9NQU5	1:1:1:1:1	Compleat	Compleat:HC1807	9003780
GIT1-ARHGEF7-PAK1-PXN complex	ARHGEF7 GIT1 PAK1 PXN	P49023 Q13153 Q14155 Q9Y2X7	0:0:0:0	CORUM	CORUM:6341	16944954
	ACTA1 ACTB CDC42 FHOD1 FMNL2 NRAP PAK1 PFN1 RAC1 TBC1D3F	A6NER0 P07737 P60709 P60953 P63000 P68133 Q13153 Q86VF7 Q96PY5 Q9Y613	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7706
	AKT1 AKT2 AKT3 CDC37 CDK11B HSP90AA1 PAK1 PDPK1 PRKCD PRKCI PRKCZ UBC	O15530 P07900 P0CG48 P21127 P31749 P31751 P41743 Q05513 Q05655 Q13153 Q16543 Q9Y243	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6406
	CCNB1 CCND3 CDK11B FOXL2 FOXO1 PAK1	P14635 P21127 P30281 P58012 Q12778 Q13153	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5826
	CSNK2A1 MAZ PAK1	P56270 P68400 Q13153	1:1:1	CompleatCFinder	Compleat:HC3716
	PAK1 RAC3	P60763 Q13153	1:1	PDB	PDB:2qme
	ARHGEF7 GIT1 GIT2 PAK1 PAK2 YWHAG	P61981 Q13153 Q13177 Q14155 Q14161 Q9Y2X7	1:1:1:1:1:1	CompleatCFinder	Compleat:HC7135
	PAK1	Q13153	4	PDB	PDB:1f3mPDB:5deyPDB:9d4xPDB:9n48PDB:4zjiPDB:4o0tPDB:5kbrPDB:4zy5PDB:4zjjPDB:9nbxPDB:9d4wPDB:9d50PDB:3q4zPDB:9d4vPDB:4zy4PDB:5imePDB:4zy6PDB:5dewPDB:5kbqPDB:6b16PDB:7vtoPDB:4p90PDB:9n4uPDB:4zloPDB:9d4yPDB:4o0r

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	R SequencingMass spectrometry	1	32384937

Sequence, Structure & Domains

Sequences

Length

545

Mass

60,647

Sequence

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q13153-1; Sequence=Displayed; Name=2; Synonyms=PAK1B; IsoId=Q13153-2; Sequence=VSP_017507

Alternative Sequence

518..545; HQFLKIAKPLSSLTPLIAAAKEATKNNH -> VRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS (in isoform 2)

3D Structural Models

Turn

91..94; 290..292; 463..466; 506..508

Helix

101..108; 114..119; 121..135; 250..260; 266..268; 303..305; 309..321; 352..358; 363..382; 392..394; 428..430; 433..437; 444..459; 469..479; 487..489; 492..501; 512..515; 519..523; 527..530; 531..540

Beta Strand

79..87; 95..98; 195..198; 214..219; 261..264; 270..272; 274..279; 282..289; 295..302; 330..336; 339..345; 349..351; 395..397; 403..405; 408..410; 416..418

3D Structure

NMR spectroscopy (1); X-ray crystallography (36)

Domain & Motif Annotations

Compositional Bias

68..77; Basic and acidic residues; 174..184; Acidic residues; 220..231; Polar residues

Domain (FT)

75..88; CRIB; 270..521; Protein kinase

Region

1..77; Disordered; 70..140; Autoregulatory region; 75..105; GTPase-binding; 159..198; Disordered; 211..251; Disordered

Protein Families (3)

Protein kinase superfamily
STE Ser/Thr protein kinase family
STE20 subfamily

Sequence Similarities

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.

Clinical Relevance

Disease Involvement (3)

Disease variantEpilepsyIntellectual disability

Related Diseases (2)

Epilepsy Intellectual disability

Drugs (10)

CENISERTIB PF-562271 BARASERTIB-HQPA NVP-TAE684 MLN-8054 LAUROGUADINE TOZASERTIB ILORASERTIB TAMATINIB RG-1530

Antibody (2)

HPA003565 CAB005312

Interaction Protein (12)

ENSG00000070831ENSG00000071051ENSG00000088986ENSG00000102606ENSG00000106683ENSG00000108262ENSG00000116574ENSG00000126785ENSG00000129675ENSG00000136238ENSG00000139436ENSG00000146648

Interaction Count

Interaction Dataset (2)

intact_biogridintact_biogrid_opencell

Supporting Publications4

PMID	Title	Related sentences
30301952	A position on vision.	No related sentences available
38343172	Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles.	No related sentences available
40222457	Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement.	No related sentences available
40595564	Enrichment of extracellular vesicles using Mag-Net for the analysis of the plasma proteome.	No related sentences available