Protein detail
CLN3
Battenin (Batten disease protein) (Protein CLN3)
Entry name CLN3 | UniProt ID | EVMP score 0.38 |
Frequency 8 | Transmembrane count 6 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Battenin (Batten disease protein) (Protein CLN3)
Protein Class
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases
Transmembrane
38..58; Helical; 128..148; Helical; 152..172; Helical; 183..203; Helical; 278..298; Helical; 347..367; Helical
Transmembrane Count
6
Ensembl
Entrez Gene Symbol
Gene Synonym
BTN1BTSJNCL
Gene Description
CLN3 lysosomal/endosomal transmembrane protein, battenin
Chromosome
16
Position
28474111-28495575
Frequency
8
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificPlateletsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005764 lysosome
- GO:0005765 lysosomal membrane
- GO:0005769 early endosome
- GO:0005770 late endosome
- GO:0005776 autophagosome
- GO:0005783 endoplasmic reticulum
- GO:0005789 endoplasmic reticulum membrane
- GO:0005794 Golgi apparatus
- GO:0005795 Golgi stack
- GO:0005802 trans-Golgi network
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0008021 synaptic vesicle
- GO:0016020 membrane
- GO:0031901 early endosome membrane
- GO:0031902 late endosome membrane
- GO:0043005 neuron projection
- GO:0044754 autolysosome
- GO:0045121 membrane raft
- GO:0055037 recycling endosome
Molecular Function
Biological Process
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CDK1 | P06493 | CLN3 | Q13286 | Yes | No | Yes | SIGNOR | SIGNOR:23217712 |
Protein Complex Composition
1 record.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CLN3GLE1NUP107NUP133NUP155NUP205NUP214NUP93NUP98NXF1RAE1SEH1LUBC | O75694P0CG48P35658P52948P57740P78406Q13286Q53GS7Q8N1F7Q8WUM0Q92621Q96EE3Q9UBU9 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7755 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | R SequencingMass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
438
Mass
47,623
Sequence
MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVFKGLLWYIVPLVVVYFAEYFINQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS
Alternative Products
Event=Alternative splicing; Named isoforms=7; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q13286-1; Sequence=Displayed; Name=2; IsoId=Q13286-2; Sequence=VSP_004166; Name=3; IsoId=Q13286-3; Sequence=VSP_004167; Name=4; IsoId=Q13286-4; Sequence=VSP_004168; Name=5; IsoId=Q13286-5; Sequence=VSP_004169, VSP_004170; Name=6; IsoId=Q13286-6; Sequence=VSP_047631, VSP_047632; Name=7; IsoId=Q13286-7; Sequence=VSP_057347
Alternative Sequence
75..98; Missing (in isoform 7); 99..127; AVLLADILPTLVIKLLAPLGLHLLPYSPR -> PPGSRQWDLCCWKLRPGCLFSFCGDQPVC (in isoform 6); 128..226; Missing (in isoform 6); 155..264; Missing (in isoform 5); 178..225; Missing (in isoform 2); 280..302; GLLWYIVPLVVVYFAEYFINQGL -> VRMMAG (in isoform 3); 322..438; Missing (in isoform 4); 353..438; CLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS -> MESRSVAQAGM (in isoform 5)
3D Structural Models
Domain & Motif Annotations
Motif
242..244; Lysosomal targeting motif; 253..254; Lysosomal targeting motif. Required for AP1G1, AP2A2 and AP3D1 interaction; 409..419; Lysosomal targeting motif
Domain (CC)
The C-terminal (153-438) mediates KCNIP3 interaction and the cytoprotective activity (PubMed:17189291). the dileucine motif mediates AP1G1 and AP3D1 interaction (PubMed:15598649).
Region
1..25; Disordered; 237..268; Disordered
Protein Families
Battenin family
Sequence Similarities
Belongs to the battenin family.
Clinical Relevance
Disease Involvement
Disease variantNeurodegenerationNeuronal ceroid lipofuscinosis
Related Diseases
Biomarker
Phase 1/2
Antibody