Protein detail
CLN3
Battenin (Batten disease protein) (Protein CLN3)
Entry name CLN3 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 8 | Transmembrane count 6 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Battenin (Batten disease protein) (Protein CLN3)
Protein Class (6)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases
Transmembrane
38..58; Helical; 128..148; Helical; 152..172; Helical; 183..203; Helical; 278..298; Helical; 347..367; Helical
Transmembrane Count
6
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
BTN1BTSJNCL
Gene Description
CLN3 lysosomal/endosomal transmembrane protein, battenin
Chromosome
16
Position
28474111-28495575
Supporting publications (n)
8
EVMP confidence score
0.63
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificPlateletsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of lipid/glycolipid metabolism
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases
Cellular Component (24)
- GO:0000139 Golgi membrane
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005764 lysosome
- GO:0005765 lysosomal membrane
- GO:0005769 early endosome
- GO:0005770 late endosome
- GO:0005776 autophagosome
- GO:0005783 endoplasmic reticulum
- GO:0005789 endoplasmic reticulum membrane
Page 1 of 3
Molecular Function (5)
Biological Process (3)
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence20
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | LOCATE |
Page 1 of 2Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CDK1 | P06493 | CLN3 | Q13286 | Yes | Yes | SIGNOR | SIGNOR:23217712 |
Protein Complex Composition (1)
1 record.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CLN3GLE1NUP107NUP133NUP155NUP205NUP214NUP93NUP98NXF1RAE1SEH1LUBC | O75694P0CG48P35658P52948P57740P78406Q13286Q53GS7Q8N1F7Q8WUM0Q92621Q96EE3Q9UBU9 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7755 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | R SequencingMass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
438
Mass
47,623
Sequence
MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVFKGLLWYIVPLVVVYFAEYFINQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS
Alternative Products
Event=Alternative splicing; Named isoforms=7; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q13286-1; Sequence=Displayed; Name=2; IsoId=Q13286-2; Sequence=VSP_004166; Name=3; IsoId=Q13286-3; Sequence=VSP_004167; Name=4; IsoId=Q13286-4; Sequence=VSP_004168; Name=5; IsoId=Q13286-5; Sequence=VSP_004169, VSP_004170; Name=6; IsoId=Q13286-6; Sequence=VSP_047631, VSP_047632; Name=7; IsoId=Q13286-7; Sequence=VSP_057347
Alternative Sequence
75..98; Missing (in isoform 7); 99..127; AVLLADILPTLVIKLLAPLGLHLLPYSPR -> PPGSRQWDLCCWKLRPGCLFSFCGDQPVC (in isoform 6); 128..226; Missing (in isoform 6); 155..264; Missing (in isoform 5); 178..225; Missing (in isoform 2); 280..302; GLLWYIVPLVVVYFAEYFINQGL -> VRMMAG (in isoform 3); 322..438; Missing (in isoform 4); 353..438; CLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS -> MESRSVAQAGM (in isoform 5)
Domain & Motif Annotations
Motif
242..244; Lysosomal targeting motif; 253..254; Lysosomal targeting motif. Required for AP1G1, AP2A2 and AP3D1 interaction; 409..419; Lysosomal targeting motif
Domain (CC)
The C-terminal (153-438) mediates KCNIP3 interaction and the cytoprotective activity (PubMed:17189291). the dileucine motif mediates AP1G1 and AP3D1 interaction (PubMed:15598649).
Region
1..25; Disordered; 237..268; Disordered
Protein Families
Battenin family
Sequence Similarities
Belongs to the battenin family.
Clinical Relevance
Disease Involvement (3)
Disease variantNeurodegenerationNeuronal ceroid lipofuscinosis
Related Diseases (2)
Biomarker
Phase 1/2
Antibody
Supporting Publications8
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 29045505 | Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients. | Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers. |
| 30408591 | Portrait of blood-derived extracellular vesicles in patients with Parkinson's disease. | No related sentences available |
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No related sentences available |
| 33204424 | Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No related sentences available |
| 39558134 | Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis. | No related sentences available |