Protein detail
LSAMP
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Protein symbol LSAMP | UniProt ID | EVMP score 0.63 |
Frequency 25 | Transmembrane count | Protein classification |
Basic Information
Protein Names
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Frequency
25
EVMP Score
0.63
Fluorescence & Localization
Tissue SpecificintestineCell SpecificAlveolar cells type 1
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Reactome
Canonical Pathways
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Metabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | Yes | Yes |
| ecm | ecm | OmniPath | Yes | No | No | Yes | Yes |
| extracellular | extracellular | OmniPath | No | No | No | Yes | Yes |
| intracellular | intracellular | ComPPI | No | No | No | Yes | Yes |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | Yes |
| intracellular | intracellular | OmniPath | No | No | No | Yes | Yes |
| iglon | cell_adhesion | HGNC | Yes | Yes | No | Yes | Yes |
| adhesion | adhesion | HGNC | Yes | Yes | No | Yes | Yes |
| adhesion | adhesion | MCAM | Yes | Yes | No | Yes | Yes |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | Yes |
Page 1 of 4Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains
Sequences
Length
338
Mass
37,393
Sequence
MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC
3D Structural Models
Domain & Motif Annotations
Domain (FT)
29..122; Ig-like C2-type 1; 132..214; Ig-like C2-type 2; 219..304; Ig-like C2-type 3
Protein Families
- Immunoglobulin superfamily
- IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.