Protein detail
LSAMP
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Entry name LSAMP | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 25 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
25
EVMP confidence score
0.63
Fluorescence & Localization
Tissue SpecificintestineCell SpecificAlveolar cells type 1
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function
Biological Process (3)
Reactome (2)
Canonical Pathways (3)
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Metabolism mediation
Relations & Evidence34
Ligand-Receptor Signaling (33)
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | Yes | Yes | ||
| ecm | ecm | OmniPath | Yes | Yes | Yes | ||
| extracellular | extracellular | OmniPath | Yes | Yes | |||
| intracellular | intracellular | ComPPI | Yes | Yes | |||
| intracellular | intracellular | GO_Intercell | Yes | Yes | |||
| intracellular | intracellular | OmniPath | Yes | Yes | |||
| iglon | cell_adhesion | HGNC | Yes | Yes | Yes | Yes | |
| adhesion | adhesion | HGNC | Yes | Yes | Yes | Yes | |
| adhesion | adhesion | MCAM | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes |
Page 1 of 4Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains
Sequences
Length
338
Mass
37,393
Sequence
MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC
Domain & Motif Annotations
Domain (FT)
29..122; Ig-like C2-type 1; 132..214; Ig-like C2-type 2; 219..304; Ig-like C2-type 3
Protein Families (2)
- Immunoglobulin superfamily
- IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.
Supporting Publications25
| PMID | Title | Related sentences |
|---|---|---|
| 28680152 | Exosomes from metastatic cancer cells transfer amoeboid phenotype to non-metastatic cells and increase endothelial permeability: their emerging role in tumor heterogeneity. | No related sentences available |
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No related sentences available |
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No related sentences available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 32916986 | Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines. | No related sentences available |
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No related sentences available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No related sentences available |
| 34473505 | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No related sentences available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No related sentences available |
Page 1 of 3Next