Protein detail

LSAMP

Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)

Entry name
LSAMP
UniProt ID
EVMP confidence score
0.63
Supporting publications (n)
25
Transmembrane count
Protein classification
Basic Information
Protein Names
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Protein Function
Predicted intracellular proteins
Entrez Gene Symbol
Supporting publications (n)
25
EVMP confidence score
0.63
Fluorescence & Localization
LSAMP fluorescence
Tissue SpecificintestineCell SpecificAlveolar cells type 1
Function & Pathway
Protein Function
Predicted intracellular proteins
Molecular Function
Canonical Pathways (3)
  • M5880 Naba ecm affiliated
  • M5885 Naba matrisome associated
  • M5889 Naba matrisome
Mediation Categories
Metabolism mediation
Relations & Evidence34

Ligand-Receptor Signaling (33)

33 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembrane_phobiustransmembrane_predictedAlmen2009YesYes
transmembrane_sosuitransmembrane_predictedAlmen2009YesYes
transmembrane_tmhmmtransmembrane_predictedAlmen2009YesYes
Page 4 of 4Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyMass spectrometryWestern blotting138716512
Sequence, Structure & Domains

Sequences

Length
338
Mass
37,393
Sequence
MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC

Domain & Motif Annotations

Domain (FT)
29..122; Ig-like C2-type 1; 132..214; Ig-like C2-type 2; 219..304; Ig-like C2-type 3
Protein Families (2)
  • Immunoglobulin superfamily
  • IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.
Supporting Publications25
PMIDTitleRelated sentences
28680152Exosomes from metastatic cancer cells transfer amoeboid phenotype to non-metastatic cells and increase endothelial permeability: their emerging role in tumor heterogeneity.No related sentences available
32230970Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.No related sentences available
32560723T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles.No related sentences available
32854315Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
32916986Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines.No related sentences available
33309826Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts.No related sentences available
33592500A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia.No related sentences available
34473505Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles.Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles.
34576246Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.No related sentences available
36064647Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells.No related sentences available
Page 1 of 3Next