Protein detail
LSAMP
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Entry name LSAMP | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 25 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Limbic system-associated membrane protein (LSAMP) (IgLON family member 3)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
25
EVMP confidence score
0.63
Fluorescence & Localization3
Tissue SpecificintestineCell SpecificAlveolar cells type 1
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function
Biological Process (3)
Reactome (2)
Canonical Pathways (3)
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Metabolism mediation
Relations & Evidence34
Ligand-Receptor Signaling (33)
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | Yes | Yes |
| ecm | ecm | OmniPath | Yes | No | No | Yes | Yes |
| extracellular | extracellular | OmniPath | No | No | No | Yes | Yes |
| intracellular | intracellular | ComPPI | No | No | No | Yes | Yes |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | Yes |
| intracellular | intracellular | OmniPath | No | No | No | Yes | Yes |
| iglon | cell_adhesion | HGNC | Yes | Yes | No | Yes | Yes |
| adhesion | adhesion | HGNC | Yes | Yes | No | Yes | Yes |
| adhesion | adhesion | MCAM | Yes | Yes | No | Yes | Yes |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | Yes |
Page 1 of 4Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains6
Sequences
Length
338
Mass
37,393
Sequence
MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC
Domain & Motif Annotations
Domain (FT)
29..122; Ig-like C2-type 1; 132..214; Ig-like C2-type 2; 219..304; Ig-like C2-type 3
Protein Families (2)
- Immunoglobulin superfamily
- IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.
Supporting Publications25
| PMID | Title | Abstract |
|---|---|---|
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |
| 40831280 | Syntenin Controls Extracellular Vesicle-Induced Tumour Migration by Regulating the Expression of Adhesion Proteins on Small Extracellular Vesicles. | No abstract available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No abstract available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |
Page 3 of 3Previous